Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-18, Dog (His)

IL-18 protein is a pro-inflammatory cytokine that is critical for epithelial barrier repair and immune regulation, especially in Th1 and NK cell responses. IL18R1 and IL18RAP combine to form a signaling ternary complex that activates NF-kappa-B and induces inflammatory mediators. IL-18 Protein, Dog (His) is the recombinant dog-derived IL-18 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

IL-18 Protein, Dog (His), Dog, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-18-protein-dog-his.html

Smiles

YFGKLEPKLSIIRNLNDQVLFVNEGNQPVFEDMPDSDCTDNAPHTIFIIYMYKDSLTRGLAVTISVKYKTMSTLSCKNKTISFQKMSPPDSINDEGNDIIFFQRSVPGHDDKIQFESSLYKGHFLACKKENDLFKLILKDKDENGDKSIMFTVQNKS

Molecular Formula

403796 (Gene_ID) Q9XSR0 (Y37-S193) (Accession)

Molecular Weight

Approximately 20-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

D-Apiose (~0.9 M in water)
TRC-A726650-2.5MG 2.5 mg

D-Apiose (~0.9 M in water)

Ask
View Details
TLR10-set siRNA/shRNA/RNAi Lentivector (Human)
46771091 4x 500 ng

TLR10-set siRNA/shRNA/RNAi Lentivector (Human)

Ask
View Details
NRP1 Expression Lentivector, pCDH-CMV-NRP1-EF1α-Neo (Plasmid)
CVD19-140PA-1 10 µg

NRP1 Expression Lentivector, pCDH-CMV-NRP1-EF1α-Neo (Plasmid)

Ask
View Details
Human Angiopoietin Like Protein 1 ELISA Kit
MBS762493-01 48 Well

Human Angiopoietin Like Protein 1 ELISA Kit

Ask
View Details
Human Angiopoietin Like Protein 1 ELISA Kit
MBS762493-02 96 Well

Human Angiopoietin Like Protein 1 ELISA Kit

Ask
View Details
Human Angiopoietin Like Protein 1 ELISA Kit
MBS762493-03 5x 96 Well

Human Angiopoietin Like Protein 1 ELISA Kit

Ask
View Details