Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Carbonic Anhydrase 4, Human (HEK293, His)

Carbonic anhydrase 4 catalyzes the reversible hydration of carbon dioxide and plays a crucial role in maintaining intracellular and extracellular pH. Carbonic Anhydrase 4 Protein, Human (HEK293, His) is the recombinant human-derived Carbonic Anhydrase 4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Carbonic Anhydrase 4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/carbonic-anhydrase-4-protein-human-hek293-his.html

Purity

95.00

Smiles

MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIK

Molecular Formula

762 (Gene_ID) P22748-1 (A19-K283) (Accession)

Molecular Weight

Approximately 33 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human KIR3DL3 sgRNA gene knockout kit - Lentiviral human KIR3DL3 sgRNA gene knockout kit (100)

GTR15358927 1 Vial

Lentiviral human KIR3DL3 sgRNA gene knockout kit - Lentiviral human KIR3DL3 sgRNA gene knockout kit (100)

Sign In for Pricing

Rabbit Polyclonal ADK Antibody [DyLight 405]

NBP3-00077V 0.1 mL

Rabbit Polyclonal ADK Antibody [DyLight 405]

Sign In for Pricing

PSMB10 (Proteasome Subunit beta Type-10, Proteasome Subunit beta-2i, Proteasome MECl-1, Macropain Subunit MECl-1, Multicatalytic Endopeptidase Complex Subunit MECl-1, Low Molecular Mass Protein 10, LMP10, MECL1, MGC1665) (AP)

MBS6133184-01 0.1 mL

PSMB10 (Proteasome Subunit beta Type-10, Proteasome Subunit beta-2i, Proteasome MECl-1, Macropain Subunit MECl-1, Multicatalytic Endopeptidase Complex Subunit MECl-1, Low Molecular Mass Protein 10, LMP10, MECL1, MGC1665) (AP)

Sign In for Pricing

PSMB10 (Proteasome Subunit beta Type-10, Proteasome Subunit beta-2i, Proteasome MECl-1, Macropain Subunit MECl-1, Multicatalytic Endopeptidase Complex Subunit MECl-1, Low Molecular Mass Protein 10, LMP10, MECL1, MGC1665) (AP)

MBS6133184-02 5x 0.1 mL

PSMB10 (Proteasome Subunit beta Type-10, Proteasome Subunit beta-2i, Proteasome MECl-1, Macropain Subunit MECl-1, Multicatalytic Endopeptidase Complex Subunit MECl-1, Low Molecular Mass Protein 10, LMP10, MECL1, MGC1665) (AP)

Sign In for Pricing

RAMP1 Antibody

ABD8597 100 µg

RAMP1 Antibody

Sign In for Pricing

Fry 3'UTR GFP Stable Cell Line

TU156744 1.0 mL

Fry 3'UTR GFP Stable Cell Line

Sign In for Pricing