Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Carbonic Anhydrase 4, Human (HEK293, His)

Carbonic anhydrase 4 catalyzes the reversible hydration of carbon dioxide and plays a crucial role in maintaining intracellular and extracellular pH. Carbonic Anhydrase 4 Protein, Human (HEK293, His) is the recombinant human-derived Carbonic Anhydrase 4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Carbonic Anhydrase 4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/carbonic-anhydrase-4-protein-human-hek293-his.html

Purity

95.00

Smiles

MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIK

Molecular Formula

762 (Gene_ID) P22748-1 (A19-K283) (Accession)

Molecular Weight

Approximately 33 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

2'-Deoxy-2'-fluoro-beta-D-arabinocytidine hydrochloride
MBS5826021 Inquire

2'-Deoxy-2'-fluoro-beta-D-arabinocytidine hydrochloride

Sign In for Pricing
View Details
Secreted And Transmembrane Protein 1 (SECTM1) BioAssayTM ELISA Kit (Human) discontinued
027970-01 48 Tests

Secreted And Transmembrane Protein 1 (SECTM1) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
Secreted And Transmembrane Protein 1 (SECTM1) BioAssayTM ELISA Kit (Human) discontinued
027970-02 96 Tests

Secreted And Transmembrane Protein 1 (SECTM1) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
IITZ-01
B2378-1 1 mg

IITZ-01

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD64 Antibody
JOT22041F 20Tests

PE/Cyanine5 Anti-Mouse CD64 Antibody

Sign In for Pricing
View Details
Rpp21 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3531804 1.0 µg DNA

Rpp21 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details