Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Carbonic Anhydrase 4, Human (HEK293, His)

Carbonic anhydrase 4 catalyzes the reversible hydration of carbon dioxide and plays a crucial role in maintaining intracellular and extracellular pH. Carbonic Anhydrase 4 Protein, Human (HEK293, His) is the recombinant human-derived Carbonic Anhydrase 4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Carbonic Anhydrase 4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/carbonic-anhydrase-4-protein-human-hek293-his.html

Purity

95.00

Smiles

MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIK

Molecular Formula

762 (Gene_ID) P22748-1 (A19-K283) (Accession)

Molecular Weight

Approximately 33 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Crybg2 (NM_001162970) Mouse Recombinant Protein
TP514319 20 µg

Crybg2 (NM_001162970) Mouse Recombinant Protein

Sign In for Pricing
View Details
Lentiviral human RESP18 shRNA (UAS) - Lentiviral human RESP18 shRNA (UAS, GFP) plasmid
GTR15335833 1 Vial

Lentiviral human RESP18 shRNA (UAS) - Lentiviral human RESP18 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Exosc9 (NM_019393) Mouse Tagged ORF Clone
MR217683 10 µg

Exosc9 (NM_019393) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal MxA/Mx1 Antibody (MX1/7530) [Janelia Fluor 525]
NBP3-26971JF525 0.1 mL

Mouse Monoclonal MxA/Mx1 Antibody (MX1/7530) [Janelia Fluor 525]

Sign In for Pricing
View Details
5-Aminoisotonitazene
MF-0059271-01 10 mg

5-Aminoisotonitazene

Sign In for Pricing
View Details
5-Aminoisotonitazene
MF-0059271-02 50 mg

5-Aminoisotonitazene

Sign In for Pricing
View Details