Carbonic Anhydrase 4, Human (HEK293, His)
Carbonic anhydrase 4 catalyzes the reversible hydration of carbon dioxide and plays a crucial role in maintaining intracellular and extracellular pH. Carbonic Anhydrase 4 Protein, Human (HEK293, His) is the recombinant human-derived Carbonic Anhydrase 4 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
Carbonic Anhydrase 4 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/carbonic-anhydrase-4-protein-human-hek293-his.html
Purity
95.00
Smiles
MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIK
Molecular Formula
762 (Gene_ID) P22748-1 (A19-K283) (Accession)
Molecular Weight
Approximately 33 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
TL713798V 500 µL Each
Wdr12 Rat shRNA Lentiviral Particle (Locus ID 363237)
Sign In for Pricing
View Details 
MBS711327-01 0.1 mL
Rabbit anti-human TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa polyclonal Antibody
Sign In for Pricing
View Details 
MBS711327-02 5x 0.1 mL
Rabbit anti-human TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa polyclonal Antibody
Sign In for Pricing
View Details MBS7224340-01 48 Well
Guinea pig Apoptosis-inducing factor 2 (AIFM2) ELISA Kit
Sign In for Pricing
View Details MBS7224340-02 96 Well
Guinea pig Apoptosis-inducing factor 2 (AIFM2) ELISA Kit
Sign In for Pricing
View Details MBS7224340-03 5x 96 Well
Guinea pig Apoptosis-inducing factor 2 (AIFM2) ELISA Kit
Sign In for Pricing
View Details