Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Carbonic Anhydrase 4, Human (HEK293, His)

Carbonic anhydrase 4 catalyzes the reversible hydration of carbon dioxide and plays a crucial role in maintaining intracellular and extracellular pH. Carbonic Anhydrase 4 Protein, Human (HEK293, His) is the recombinant human-derived Carbonic Anhydrase 4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Carbonic Anhydrase 4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/carbonic-anhydrase-4-protein-human-hek293-his.html

Purity

95.00

Smiles

MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIK

Molecular Formula

762 (Gene_ID) P22748-1 (A19-K283) (Accession)

Molecular Weight

Approximately 33 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 5/6/18 Antibody
V8319-100UG 100 µg

Cytokeratin 5/6/18 Antibody

Sign In for Pricing
View Details
Monoclonal Parathyroid Hormone (PTH) (N-Terminal) Antibody - With BSA and Azide, Clone: 3H9
APR14707G 0.05mg

Monoclonal Parathyroid Hormone (PTH) (N-Terminal) Antibody - With BSA and Azide, Clone: 3H9

Sign In for Pricing
View Details
DNAJC14 Human shRNA Plasmid Kit (Locus ID 85406)
TR304952 1 Kit

DNAJC14 Human shRNA Plasmid Kit (Locus ID 85406)

Sign In for Pricing
View Details
SNORD116-19 siRNA Oligos set (Human)
44789171 3x 5 nmol

SNORD116-19 siRNA Oligos set (Human)

Sign In for Pricing
View Details
PHD finger protein 21A (PHF21A) Mouse ELISA Kit
F8168 96 Tests

PHD finger protein 21A (PHF21A) Mouse ELISA Kit

Sign In for Pricing
View Details
Rat Acetyl-CoA acetyltransferase, mitochondrial ELISA Kit
MBS2880903-01 48 Well

Rat Acetyl-CoA acetyltransferase, mitochondrial ELISA Kit

Sign In for Pricing
View Details