Carbonic Anhydrase 4, Human (HEK293, His)
Carbonic anhydrase 4 catalyzes the reversible hydration of carbon dioxide and plays a crucial role in maintaining intracellular and extracellular pH. Carbonic Anhydrase 4 Protein, Human (HEK293, His) is the recombinant human-derived Carbonic Anhydrase 4 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
Carbonic Anhydrase 4 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/carbonic-anhydrase-4-protein-human-hek293-his.html
Purity
95.00
Smiles
MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIK
Molecular Formula
762 (Gene_ID) P22748-1 (A19-K283) (Accession)
Molecular Weight
Approximately 33 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6316781-01 0.2 mL
LPAR4, ID (LPAR4, GPR23, LPA4, P2RY9, Lysophosphatidic acid receptor 4, G-protein coupled receptor 23, P2Y purinoceptor 9, P2Y5-like receptor, Purinergic receptor 9) (Biotin)
Sign In for Pricing
View Details 
MBS6316781-02 5x 0.2 mL
LPAR4, ID (LPAR4, GPR23, LPA4, P2RY9, Lysophosphatidic acid receptor 4, G-protein coupled receptor 23, P2Y purinoceptor 9, P2Y5-like receptor, Purinergic receptor 9) (Biotin)
Sign In for Pricing
View Details K1187607 1.0 µg DNA
KRTAP13P2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
Sign In for Pricing
View Details 