Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Carbonic Anhydrase 4, Human (HEK293, His)

Carbonic anhydrase 4 catalyzes the reversible hydration of carbon dioxide and plays a crucial role in maintaining intracellular and extracellular pH. Carbonic Anhydrase 4 Protein, Human (HEK293, His) is the recombinant human-derived Carbonic Anhydrase 4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Carbonic Anhydrase 4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/carbonic-anhydrase-4-protein-human-hek293-his.html

Purity

95.00

Smiles

MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIK

Molecular Formula

762 (Gene_ID) P22748-1 (A19-K283) (Accession)

Molecular Weight

Approximately 33 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM159 Protein Vector (Mouse) (pPB-C-His)
PV239166 500 ng

TMEM159 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Human KCNIP1 Pre-designed siRNA Set A
SI008010A 1 Each

Human KCNIP1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
OSTA (SLC51A) Human qPCR Primer Pair (NM_152672)
HP217886 200 Reactions

OSTA (SLC51A) Human qPCR Primer Pair (NM_152672)

Sign In for Pricing
View Details
5-{[2-(6-Amino-9H-purin-9-yl)ethyl]amino}-1-pentanol
TRC-A628913-1G 1 g

5-{[2-(6-Amino-9H-purin-9-yl)ethyl]amino}-1-pentanol

Sign In for Pricing
View Details
Recombinant Human OXTR Protein, N-GST
YHD90301 100 μg

Recombinant Human OXTR Protein, N-GST

Sign In for Pricing
View Details
GART (NM_175085) Human Over-expression Lysate
LS002618-100ug 100 µg

GART (NM_175085) Human Over-expression Lysate

Sign In for Pricing
View Details