Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Carbonic Anhydrase 4, Human (HEK293, His)

Carbonic anhydrase 4 catalyzes the reversible hydration of carbon dioxide and plays a crucial role in maintaining intracellular and extracellular pH. Carbonic Anhydrase 4 Protein, Human (HEK293, His) is the recombinant human-derived Carbonic Anhydrase 4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Carbonic Anhydrase 4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/carbonic-anhydrase-4-protein-human-hek293-his.html

Purity

95.00

Smiles

MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIK

Molecular Formula

762 (Gene_ID) P22748-1 (A19-K283) (Accession)

Molecular Weight

Approximately 33 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multi-fit plug cap, green
5529G 1000/Bag

Multi-fit plug cap, green

Sign In for Pricing
View Details
Tricyclic Antidepressants (TCA) (FITC)
MBS6261768-01 0.1 mL

Tricyclic Antidepressants (TCA) (FITC)

Sign In for Pricing
View Details
Tricyclic Antidepressants (TCA) (FITC)
MBS6261768-02 5x 0.1 mL

Tricyclic Antidepressants (TCA) (FITC)

Sign In for Pricing
View Details
Nfatc2ip sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K5017608 1.0 µg DNA

Nfatc2ip sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Hamster Thymosin Beta 10 ELISA Kit
MBS044285-01 48 Well

Hamster Thymosin Beta 10 ELISA Kit

Sign In for Pricing
View Details
Hamster Thymosin Beta 10 ELISA Kit
MBS044285-02 96 Well

Hamster Thymosin Beta 10 ELISA Kit

Sign In for Pricing
View Details