Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Carbonic Anhydrase 4, Human (HEK293, His)

Carbonic anhydrase 4 catalyzes the reversible hydration of carbon dioxide and plays a crucial role in maintaining intracellular and extracellular pH. Carbonic Anhydrase 4 Protein, Human (HEK293, His) is the recombinant human-derived Carbonic Anhydrase 4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Carbonic Anhydrase 4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/carbonic-anhydrase-4-protein-human-hek293-his.html

Purity

95.00

Smiles

MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIK

Molecular Formula

762 (Gene_ID) P22748-1 (A19-K283) (Accession)

Molecular Weight

Approximately 33 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMP8B polyclonal antibody
BS67036-01 50 µL

BMP8B polyclonal antibody

Sign In for Pricing
View Details
BMP8B polyclonal antibody
BS67036-02 100 µL

BMP8B polyclonal antibody

Sign In for Pricing
View Details
PICK1, NT (Protein Interacting with PRKCA 1, Protein Interacting with C Kinase 1, PICK-1, PICK, MGC15204, Protein Kinase C alpha Binding Protein, PRKCA Binding Protein, Prkcabp) (MaxLight 650) discontinued
P4130-02N-ML650 100 µL

PICK1, NT (Protein Interacting with PRKCA 1, Protein Interacting with C Kinase 1, PICK-1, PICK, MGC15204, Protein Kinase C alpha Binding Protein, PRKCA Binding Protein, Prkcabp) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Recombinant Human POSTN
RPF11298-01 50 µg

Recombinant Human POSTN

Sign In for Pricing
View Details
Recombinant Human POSTN
RPF11298-02 200 µg

Recombinant Human POSTN

Sign In for Pricing
View Details
Recombinant Human POSTN
RPF11298-03 1 mg

Recombinant Human POSTN

Sign In for Pricing
View Details