Carbonic Anhydrase 4, Human (HEK293, His)
Carbonic anhydrase 4 catalyzes the reversible hydration of carbon dioxide and plays a crucial role in maintaining intracellular and extracellular pH. Carbonic Anhydrase 4 Protein, Human (HEK293, His) is the recombinant human-derived Carbonic Anhydrase 4 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
Carbonic Anhydrase 4 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/carbonic-anhydrase-4-protein-human-hek293-his.html
Purity
95.00
Smiles
MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIK
Molecular Formula
762 (Gene_ID) P22748-1 (A19-K283) (Accession)
Molecular Weight
Approximately 33 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
C2548-96W31 100 Tests
CD200R3 (Cell Surface Glycoprotein CD200 Receptor 3, CD200 Cell Surface Glycoprotein Receptor-like 3, CD200 Receptor-like 3, CD200 Cell Surface Glycoprotein Receptor-like b, CD200RLb, Cell Surface Glycoprotein OX2 Receptor 3, Cd200rlb) (PE) discontinued
Sign In for Pricing
View Details MR214777L3V 200 µL
4930407I10Rik (NM_001166475) Mouse Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details