Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Carbonic Anhydrase 4, Human (HEK293, His)

Carbonic anhydrase 4 catalyzes the reversible hydration of carbon dioxide and plays a crucial role in maintaining intracellular and extracellular pH. Carbonic Anhydrase 4 Protein, Human (HEK293, His) is the recombinant human-derived Carbonic Anhydrase 4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Carbonic Anhydrase 4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/carbonic-anhydrase-4-protein-human-hek293-his.html

Purity

95.00

Smiles

MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIK

Molecular Formula

762 (Gene_ID) P22748-1 (A19-K283) (Accession)

Molecular Weight

Approximately 33 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tsen2 (NM_199033) Mouse Tagged ORF Clone
MR207341 10 µg

Tsen2 (NM_199033) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal BMP-8b Antibody (13E6) [Biotin]
NBP2-42693B 100 µL

Mouse Monoclonal BMP-8b Antibody (13E6) [Biotin]

Sign In for Pricing
View Details
Inhibitor hsa-miR-3153 AAV miRNA Vector
Amh3047500 500 ng

Inhibitor hsa-miR-3153 AAV miRNA Vector

Sign In for Pricing
View Details
CLOCK Antibody
A17572-100UL 100 µL

CLOCK Antibody

Sign In for Pricing
View Details
IL17 (IL17A) Mouse Monoclonal Antibody [Clone ID: 414A11.03]
DDX0335P-100 100 µg

IL17 (IL17A) Mouse Monoclonal Antibody [Clone ID: 414A11.03]

Sign In for Pricing
View Details
Recombinant Human PSMC1 Protein, N-His
E55P2052 50 µg

Recombinant Human PSMC1 Protein, N-His

Sign In for Pricing
View Details