Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Carbonic Anhydrase 4, Human (HEK293, His)

Carbonic anhydrase 4 catalyzes the reversible hydration of carbon dioxide and plays a crucial role in maintaining intracellular and extracellular pH. Carbonic Anhydrase 4 Protein, Human (HEK293, His) is the recombinant human-derived Carbonic Anhydrase 4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Carbonic Anhydrase 4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/carbonic-anhydrase-4-protein-human-hek293-his.html

Purity

95.00

Smiles

MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIK

Molecular Formula

762 (Gene_ID) P22748-1 (A19-K283) (Accession)

Molecular Weight

Approximately 33 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERCC4 Antibody
MBS7122001-01 0.05 mg

ERCC4 Antibody

Sign In for Pricing
View Details
ERCC4 Antibody
MBS7122001-02 0.1 mg

ERCC4 Antibody

Sign In for Pricing
View Details
ERCC4 Antibody
MBS7122001-03 5x 0.1 mg

ERCC4 Antibody

Sign In for Pricing
View Details
CD200R3 (Cell Surface Glycoprotein CD200 Receptor 3, CD200 Cell Surface Glycoprotein Receptor-like 3, CD200 Receptor-like 3, CD200 Cell Surface Glycoprotein Receptor-like b, CD200RLb, Cell Surface Glycoprotein OX2 Receptor 3, Cd200rlb) (PE) discontinued
C2548-96W31 100 Tests

CD200R3 (Cell Surface Glycoprotein CD200 Receptor 3, CD200 Cell Surface Glycoprotein Receptor-like 3, CD200 Receptor-like 3, CD200 Cell Surface Glycoprotein Receptor-like b, CD200RLb, Cell Surface Glycoprotein OX2 Receptor 3, Cd200rlb) (PE) discontinued

Sign In for Pricing
View Details
4930407I10Rik (NM_001166475) Mouse Tagged ORF Clone Lentiviral Particle
MR214777L3V 200 µL

4930407I10Rik (NM_001166475) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Porcine CD48 antigen (CD48) ELISA Kit
MBS7228411-01 48 Well

Porcine CD48 antigen (CD48) ELISA Kit

Sign In for Pricing
View Details