Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Carbonic Anhydrase 4, Human (HEK293, His)

Carbonic anhydrase 4 catalyzes the reversible hydration of carbon dioxide and plays a crucial role in maintaining intracellular and extracellular pH. Carbonic Anhydrase 4 Protein, Human (HEK293, His) is the recombinant human-derived Carbonic Anhydrase 4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Carbonic Anhydrase 4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/carbonic-anhydrase-4-protein-human-hek293-his.html

Purity

95.00

Smiles

MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIK

Molecular Formula

762 (Gene_ID) P22748-1 (A19-K283) (Accession)

Molecular Weight

Approximately 33 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Desmocollin 1 (DSC1)
RPU41175-01 50 µg

Recombinant Human Desmocollin 1 (DSC1)

Sign In for Pricing
View Details
Recombinant Human Desmocollin 1 (DSC1)
RPU41175-02 100 µg

Recombinant Human Desmocollin 1 (DSC1)

Sign In for Pricing
View Details
Recombinant Human Desmocollin 1 (DSC1)
RPU41175-03 1 mg

Recombinant Human Desmocollin 1 (DSC1)

Sign In for Pricing
View Details
Gsg1 3'UTR Luciferase Stable Cell Line
TU205501 1.0 mL

Gsg1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rabbit Polyclonal Cytosolic Sulfotransferase 1A1/SULT1A1 Antibody [Biotin]
NBP2-99855B 0.1 mL

Rabbit Polyclonal Cytosolic Sulfotransferase 1A1/SULT1A1 Antibody [Biotin]

Sign In for Pricing
View Details
Matrilin 4 (MATN4) Antibody
abx317011-01 20 µg

Matrilin 4 (MATN4) Antibody

Sign In for Pricing
View Details