Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A15A, Mouse (solution)

The S100A15A protein is part of the Tyr protein kinase family in the ROR subfamily and is related to phosphorylation events, especially phosphorylation events on tyrosine residues. Its association with the receptor tyrosine kinase-like orphan receptor (ROR) family suggests its potential role in cell signaling pathways, affecting processes such as cell growth and differentiation. S100A15A Protein, Mouse (solution) is the recombinant mouse-derived S100A15A protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

S100A15A Protein, Mouse (solution), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a15a-protein-mouse-solution.html

Purity

98.0

Smiles

MPDTPVEDSLFQIIHCFHHYAAREGDKETLSLEELKALLLDSVPRFMDTLGRRQPYYITELFRAADKNKDNQICFDEFLYILGKLVKDYHLQFHRQLCAHYCTEHSLY

Molecular Formula

381493 (Gene_ID) Q6S5I3 (M1-Y108) (Accession)

Molecular Weight

Approximately 12.0 kDa.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL
BNC740276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF405S conjugate, 0.1mg/mL
BNC040851-100 1x 100 µL

HSP60 (LK1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL
BNC040270-500 1x 500 µL

Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF594 conjugate, 0.1mg/mL
BNC940146-100 1x 100 µL

CD10 (CB-CALLA), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF405M conjugate, 0.1mg/mL
BNC050322-100 1x 100 µL

CD3e (RIV9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details