Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHH, Mouse (C25II)

SHH Protein, Mouse (C25II) is a recombinant mouse sonic hedgehog variant.

Product Specifications

Product Name Alternative

SHH Protein, Mouse (C25II), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/shh-protein-mouse-c25ii.html

Purity

98.0

Smiles

IIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

Molecular Formula

20423 (Gene_ID) Q62226 (C25-G198, C25II) (Accession)

Molecular Weight

Approximately 19.7-23 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Garcia ADR, et al. The Elegance of Sonic Hedgehog: Emerging Novel Functions for a Classic Morphogen. J Neurosci. 2018 Oct 31;38 (44) :9338-9345.|[2]Gomes DC, et al. Sonic hedgehog signaling is active in human adrenal cortex development and deregulated in adrenocortical tumors. J Clin Endocrinol Metab. 2014 Jul;99 (7) :E1209-16.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CACNG6 (NM_145814) Human Recombinant Protein
TP305809L 1 mg

CACNG6 (NM_145814) Human Recombinant Protein

Sign In for Pricing
View Details
InsP3R1 (Ab-1598/1588) Antibody
8B1070-AAT 50 µg

InsP3R1 (Ab-1598/1588) Antibody

Sign In for Pricing
View Details
Human SNAI3 activation kit by CRISPRa
GA117335 1 Kit

Human SNAI3 activation kit by CRISPRa

Sign In for Pricing
View Details
HypoGel® 200 FMP
SP200110150160.100G 100 g

HypoGel® 200 FMP

Sign In for Pricing
View Details
Human Hexokinase 1 (HK1) ELISA Kit
RD-HK1-Hu-01 96 Tests

Human Hexokinase 1 (HK1) ELISA Kit

Sign In for Pricing
View Details
Human Hexokinase 1 (HK1) ELISA Kit
RD-HK1-Hu-02 48 Tests

Human Hexokinase 1 (HK1) ELISA Kit

Sign In for Pricing
View Details