Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Silicibacter pomeroyi UPF0061 protein SPO2480 (SPO2480)

Product Specifications

CAS Number

9000-83-3

Gene Name

[SPO2480]

Storage Conditions

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Other Gene Names

[SPO2480]

Short Name

[UPF0061 protein SPO2480 (SPO2480)]

Other Product Names

[YdiU family protein; UPF0061 protein SPO2480]

NCBI GI Number

763148780

NCBI Accession Number

WP_044028445.1

NCBI GB Accession Number

WP_044028445.1

Uniprot Accession Number

Q5LQK9

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rnase4 (NM_201239) Mouse Recombinant Protein
TP501018SE 20 µg

Rnase4 (NM_201239) Mouse Recombinant Protein

Sign In for Pricing
View Details
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
HY-P1229-01 5 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
HY-P1229-02 10 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details
1700047I17Rik2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4325508 1.0 µg DNA

1700047I17Rik2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Phospho-PAK3 (Ser154) Antibody
AF0046-01 100 µL

Phospho-PAK3 (Ser154) Antibody

Sign In for Pricing
View Details
Phospho-PAK3 (Ser154) Antibody
AF0046-02 200 µL

Phospho-PAK3 (Ser154) Antibody

Sign In for Pricing
View Details