Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus Benzil reductase (yueD)

Product Specifications

CAS Number

9000-83-3

Gene Name

[yueD]

Storage Conditions

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Other Gene Names

[yueD]

Short Name

[Benzil reductase (yueD)]

Other Product Names

[Benzil reductase ((S)-benzoin forming); Benzil reductase ((S)-benzoin forming)]

NCBI GI Number

75527692

NCBI Accession Number

Q8RJB2.1

Uniprot Accession Number

Q8RJB2

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
MBS5818163 Inquire

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details
PRRX2 Rabbit pAb
E45R28993N-100 100 µL

PRRX2 Rabbit pAb

Sign In for Pricing
View Details
Hyaluronan synthase 2 (HAS2) (NM_005328) Human Untagged Clone
SC116826 10 µg

Hyaluronan synthase 2 (HAS2) (NM_005328) Human Untagged Clone

Sign In for Pricing
View Details
STX4 Antibody, FITC conjugated
MBS1493153-01 0.05 mg

STX4 Antibody, FITC conjugated

Sign In for Pricing
View Details
STX4 Antibody, FITC conjugated
MBS1493153-02 0.1 mg

STX4 Antibody, FITC conjugated

Sign In for Pricing
View Details
STX4 Antibody, FITC conjugated
MBS1493153-03 5x 0.1 mg

STX4 Antibody, FITC conjugated

Sign In for Pricing
View Details