Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCN3B, Human (HEK293, His)

The SCN3B protein critically affects sodium channel dynamics, inducing unique sustained currents and slower inactivation rates compared to beta-1. Its interaction with NFASC is shown to guide sodium channels to the nodes of Ranvier during axonal development and retain them in mature myelinated axons. SCN3B Protein, Human (HEK293, His) is the recombinant human-derived SCN3B protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

SCN3B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scn3b-protein-human-hek293-his.html

Purity

96.0

Smiles

FPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLNDSGLYTCNVSREFEFEAHRPFVKTTRLIPLRVTEEAGEDFTSVVSE

Molecular Formula

55800 (Gene_ID) Q9NY72 (F23-E159) (Accession)

Molecular Weight

Approximately 23-34 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF761 (NM_001289952) AAV Particle
RC239464A1V 250 µL

Human ZNF761 (NM_001289952) AAV Particle

Sign In for Pricing
View Details
DFNA49 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV722679 1.0 µg DNA

DFNA49 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Slc9a3r2 ORF Vector (Mouse) (pORF)
44301015 1.0 µg DNA

Slc9a3r2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Canine CXCR4 (NP_001041491) VersaClone cDNA
RDC1066 10 µg

Canine CXCR4 (NP_001041491) VersaClone cDNA

Sign In for Pricing
View Details
Recombinant Vaccinia virus Transcript termination protein A18 (A18R)
MBS1185034-01 0.02 mg (E-Coli)

Recombinant Vaccinia virus Transcript termination protein A18 (A18R)

Sign In for Pricing
View Details
Recombinant Vaccinia virus Transcript termination protein A18 (A18R)
MBS1185034-02 0.02 mg (Yeast)

Recombinant Vaccinia virus Transcript termination protein A18 (A18R)

Sign In for Pricing
View Details