Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Transthyretin/TTR, Mouse (HEK293, His)

The transthyretin/TTR protein is a thyroid hormone binder that may transport thyroxine from the blood to the brain.It exists as a homotetramer forming a dimer of dimers with a ligand-regulated central channel suggested to play a role in thyroxine binding and transport.Transthyretin/TTR Protein, Mouse (HEK293, His) is the recombinant mouse-derived Transthyretin/TTR protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

Transthyretin/TTR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/transthyretin-ttr-protein-mouse-hek293-his.html

Purity

95.23

Smiles

GPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN

Molecular Formula

22139 (Gene_ID) P07309 (G21-N147) (Accession)

Molecular Weight

Approximately 16.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

26S proteasome non ATPase reguLatory subunit 12 (PSMD12) CytoSection
TS426555P5 25 Slides

26S proteasome non ATPase reguLatory subunit 12 (PSMD12) CytoSection

Sign In for Pricing
View Details
DLX5 Antibody - C-terminal region
ARP38586_T100-25UL 25 µL

DLX5 Antibody - C-terminal region

Sign In for Pricing
View Details
TLR6 Protein Vector (Rat) (pPM-C-HA)
46780026 500 ng

TLR6 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
FABP6 (NM_001445) Human Tagged Lenti ORF Clone
RC205307L3 10 µg

FABP6 (NM_001445) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
DiagPoly™ Plain Fluorescent Polystyrene Particles, Red, 500 μm
DCFR-L191 1 mL

DiagPoly™ Plain Fluorescent Polystyrene Particles, Red, 500 μm

Sign In for Pricing
View Details
CENPS Rabbit Polyclonal Antibody
APRab08652-01 20 µL

CENPS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details