Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Synaptophysin (Syp)

Product Specifications

Product Name Alternative

(Major synaptic vesicle protein p38)

Abbreviation

Recombinant Rat Syp protein

Gene Name

Syp

UniProt

P07825

Expression Region

1-307aa

Organism

Rattus norvegicus (Rat)

Target Sequence

MDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYTGELRLSVECANKTESALNIEVEFEYPFRLHQVYFDAPSCVKGGTTKIFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMMDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPMCRQTGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFMRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPASGGGGYGPQGDYGQQGYGQQGAPTSFSNQM

Tag

N-terminal 10xHis-tagged

Type

CF Transmembrane Protein & In Stock Protein

Source

In vitro E.coli expression system

Field of Research

Others

Relevance

Possibly involved in structural functions as organizing other membrane components or in targeting the vesicles to the plasma membrane. Involved in the regulation of short-term and long-term synaptic plasticity.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

34.8 kDa

References & Citations

"Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues." Lundby A., Secher A., Lage K., Nordsborg N.B., Dmytriyev A., Lundby C., Olsen J.V. Nat. Commun. 3:876-876 (2012)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNU6-67 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV746723 1.0 µg DNA

RNU6-67 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Spring clamp SC for 500ml flask
BAT1126 1 Each

Spring clamp SC for 500ml flask

Sign In for Pricing
View Details
Recombinant Spectrin alpha 1 Antibody / SPTA1
orb606839-01 20 µg

Recombinant Spectrin alpha 1 Antibody / SPTA1

Sign In for Pricing
View Details
Recombinant Spectrin alpha 1 Antibody / SPTA1
orb606839-02 100 µg

Recombinant Spectrin alpha 1 Antibody / SPTA1

Sign In for Pricing
View Details
Isocrenatoside
MBS5821617 Inquire

Isocrenatoside

Sign In for Pricing
View Details
Thyroxine (T4) (Biotin)
MBS6261627-01 0.1 mL

Thyroxine (T4) (Biotin)

Sign In for Pricing
View Details