Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC4C, Human (HEK293, His, Myc)

CLEC4C is a lectin-type cell surface receptor that plays a crucial role in antigen capture by dendritic cells. It specifically recognizes non-sialylated galactose-terminated biantennary glycans with the trisaccharide epitope Gal (beta1-3/4) GlcNAc (beta1-2) Man. CLEC4C Protein, Human (HEK293, His, Myc) is the recombinant human-derived CLEC4C protein, expressed by HEK293 , with N-6*His, N-Myc labeled tag.

Product Specifications

Product Name Alternative

CLEC4C Protein, Human (HEK293, His, Myc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clec4c-protein-human-hek-293-his.html

Purity

95.00

Smiles

NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI

Molecular Formula

170482 (Gene_ID) Q8WTT0-1 (N45-I213) (Accession)

Molecular Weight

Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRF (Phospho-Ser77) Antibody
orb127243-01 25 µg

SRF (Phospho-Ser77) Antibody

Sign In for Pricing
View Details
SRF (Phospho-Ser77) Antibody
orb127243-02 50 µg

SRF (Phospho-Ser77) Antibody

Sign In for Pricing
View Details
SRF (Phospho-Ser77) Antibody
orb127243-03 100 µg

SRF (Phospho-Ser77) Antibody

Sign In for Pricing
View Details
SRF (Phospho-Ser77) Antibody
orb127243-04 200 µg

SRF (Phospho-Ser77) Antibody

Sign In for Pricing
View Details
ELISA kit for Mouse Multidrug resistance-associated protein 6 (ABCC6)
KTE70531-01 48 Tests

ELISA kit for Mouse Multidrug resistance-associated protein 6 (ABCC6)

Sign In for Pricing
View Details
ELISA kit for Mouse Multidrug resistance-associated protein 6 (ABCC6)
KTE70531-02 96 Tests

ELISA kit for Mouse Multidrug resistance-associated protein 6 (ABCC6)

Sign In for Pricing
View Details