Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCL4, Human

CCL4 Protein, Human is a small cytokine of the CC chemokine subfamily that binds to the CCR5 chemokine receptor on the cell surface, promotes leukocyte aggregation under various inflammatory conditions, and contributes to immune protection against human immunodeficiency virus type 1. CCL4 Protein, Human is a recombinant human CCL4 (A24-N92) expressed by E. coli[1].

Product Specifications

Product Name Alternative

CCL4 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mip-1-beta-ccl4-protein-human.html

Purity

95.0

Smiles

APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN

Molecular Formula

6351 (Gene_ID) P13236 (A24-N92) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]S G Irving, et al. Two inflammatory mediator cytokine genes are closely linked and variably amplified on chromosome 17q. Nucleic Acids Res. 1990 Jun 11;18 (11) :3261-70.|[2]Patricia Menten, et al. Macrophage inflammatory protein-1. Cytokine Growth Factor Rev. 2002 Dec;13 (6) :455-81.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Reovirus type 2 Inner capsid protein sigma-2 (S2)
MBS1007250-01 0.02 mg (E-Coli)

Recombinant Reovirus type 2 Inner capsid protein sigma-2 (S2)

Sign In for Pricing
View Details
Recombinant Reovirus type 2 Inner capsid protein sigma-2 (S2)
MBS1007250-02 0.02 mg (Yeast)

Recombinant Reovirus type 2 Inner capsid protein sigma-2 (S2)

Sign In for Pricing
View Details
Recombinant Reovirus type 2 Inner capsid protein sigma-2 (S2)
MBS1007250-03 0.1 mg (E-Coli)

Recombinant Reovirus type 2 Inner capsid protein sigma-2 (S2)

Sign In for Pricing
View Details
Recombinant Reovirus type 2 Inner capsid protein sigma-2 (S2)
MBS1007250-04 0.1 mg (Yeast)

Recombinant Reovirus type 2 Inner capsid protein sigma-2 (S2)

Sign In for Pricing
View Details
Recombinant Reovirus type 2 Inner capsid protein sigma-2 (S2)
MBS1007250-05 0.02 mg (Baculovirus)

Recombinant Reovirus type 2 Inner capsid protein sigma-2 (S2)

Sign In for Pricing
View Details
Recombinant Reovirus type 2 Inner capsid protein sigma-2 (S2)
MBS1007250-06 0.02 mg (Mammalian-Cell)

Recombinant Reovirus type 2 Inner capsid protein sigma-2 (S2)

Sign In for Pricing
View Details