Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHH, Mouse (CHO)

SHH Protein, Mouse (CHO) is a morphogenic factor that actively orchestrates many aspects of cerebellar development and maturation.

Product Specifications

Product Name Alternative

SHH Protein, Mouse (CHO), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/shh-protein-mouse-cho.html

Purity

95.0

Smiles

CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

Molecular Formula

20423 (Gene_ID) Q62226 (C25-G198) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]De Luca A, et al. Sonic hedgehog patterning during cerebellar development. Cell Mol Life Sci. 2016 Jan; 73 (2) :291-303.|[2]Zeng Q, et al. Protective Effects of Sonic Hedgehog Against Ischemia/Reperfusion Injury in Mouse Skeletal Muscle via AKT/mTOR/p70S6K Signaling.Cell Physiol Biochem. 2017;43 (5) :1813-1828.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KDM2A Adenovirus (Rat)
25470056 1.0 mL

KDM2A Adenovirus (Rat)

Sign In for Pricing
View Details
Mouse Epha2 Antibody (Center) Blocking Peptide
MBS9220950-01 0.5 mg

Mouse Epha2 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
Mouse Epha2 Antibody (Center) Blocking Peptide
MBS9220950-02 5x 0.5 mg

Mouse Epha2 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
EIF3S1 / EIF3J Recombinant Rabbit monoclonal Antibody
HA751124 100 µL

EIF3S1 / EIF3J Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
GM4141 Adenovirus (Mouse)
22010054 1.0 mL

GM4141 Adenovirus (Mouse)

Sign In for Pricing
View Details
Trichomonas Fetus One-Step PCR kit
Oneq-V213-50D 50T

Trichomonas Fetus One-Step PCR kit

Sign In for Pricing
View Details