What is the catalog number for SHH, Mouse (CHO)?

The catalog number for SHH, Mouse (CHO) is HY-P7288.

What sizes are available for SHH, Mouse (CHO)?

SHH, Mouse (CHO) is available in the following size(s): 10 µg, 50 µg.

How many pack sizes does SHH, Mouse (CHO) come in?

SHH, Mouse (CHO) is available in 2 different pack sizes.

Is SHH, Mouse (CHO) in stock?

SHH, Mouse (CHO) is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures SHH, Mouse (CHO)?

SHH, Mouse (CHO) is manufactured by QuantiMol.

What is the estimated delivery time for SHH, Mouse (CHO)?

Estimated delivery time for SHH, Mouse (CHO) is approximately 15 business day(s), depending on your location.

SHH, Mouse (CHO)

SHH Protein, Mouse (CHO) is a morphogenic factor that actively orchestrates many aspects of cerebellar development and maturation.

Product Specifications

Product Name Alternative

SHH Protein, Mouse (CHO), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/shh-protein-mouse-cho.html

Purity

95.0

Smiles

CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

Molecular Formula

20423 (Gene_ID) Q62226 (C25-G198) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]De Luca A, et al. Sonic hedgehog patterning during cerebellar development. Cell Mol Life Sci. 2016 Jan; 73 (2) :291-303.|[2]Zeng Q, et al. Protective Effects of Sonic Hedgehog Against Ischemia/Reperfusion Injury in Mouse Skeletal Muscle via AKT/mTOR/p70S6K Signaling.Cell Physiol Biochem. 2017;43 (5) :1813-1828.