Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHH, Mouse (CHO)

SHH Protein, Mouse (CHO) is a morphogenic factor that actively orchestrates many aspects of cerebellar development and maturation.

Product Specifications

Product Name Alternative

SHH Protein, Mouse (CHO), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/shh-protein-mouse-cho.html

Purity

95.0

Smiles

CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

Molecular Formula

20423 (Gene_ID) Q62226 (C25-G198) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]De Luca A, et al. Sonic hedgehog patterning during cerebellar development. Cell Mol Life Sci. 2016 Jan; 73 (2) :291-303.|[2]Zeng Q, et al. Protective Effects of Sonic Hedgehog Against Ischemia/Reperfusion Injury in Mouse Skeletal Muscle via AKT/mTOR/p70S6K Signaling.Cell Physiol Biochem. 2017;43 (5) :1813-1828.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GFI1B (NM_004188) Human Tagged ORF Clone Lentiviral Particle
RC219503L2V 200 µL

GFI1B (NM_004188) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
APPL1 cDNA Clone
MBS1268288-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

APPL1 cDNA Clone

Ask
View Details
APPL1 cDNA Clone
MBS1268288-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

APPL1 cDNA Clone

Ask
View Details
Porcine Mas-Related G-Protein Coupled Receptor Member X3 (MRGPRX3) ELISA Kit
MBS9937327-01 48 Well

Porcine Mas-Related G-Protein Coupled Receptor Member X3 (MRGPRX3) ELISA Kit

Ask
View Details
Porcine Mas-Related G-Protein Coupled Receptor Member X3 (MRGPRX3) ELISA Kit
MBS9937327-02 96 Well

Porcine Mas-Related G-Protein Coupled Receptor Member X3 (MRGPRX3) ELISA Kit

Ask
View Details
Porcine Mas-Related G-Protein Coupled Receptor Member X3 (MRGPRX3) ELISA Kit
MBS9937327-03 5x 96 Well

Porcine Mas-Related G-Protein Coupled Receptor Member X3 (MRGPRX3) ELISA Kit

Ask
View Details