Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHH, Mouse (CHO)

SHH Protein, Mouse (CHO) is a morphogenic factor that actively orchestrates many aspects of cerebellar development and maturation.

Product Specifications

Product Name Alternative

SHH Protein, Mouse (CHO), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/shh-protein-mouse-cho.html

Purity

95.0

Smiles

CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

Molecular Formula

20423 (Gene_ID) Q62226 (C25-G198) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]De Luca A, et al. Sonic hedgehog patterning during cerebellar development. Cell Mol Life Sci. 2016 Jan; 73 (2) :291-303.|[2]Zeng Q, et al. Protective Effects of Sonic Hedgehog Against Ischemia/Reperfusion Injury in Mouse Skeletal Muscle via AKT/mTOR/p70S6K Signaling.Cell Physiol Biochem. 2017;43 (5) :1813-1828.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNRF1 siRNA (Human)
orb1854551-01 15 nmol

ZNRF1 siRNA (Human)

Sign In for Pricing
View Details
ZNRF1 siRNA (Human)
orb1854551-02 30 nmol

ZNRF1 siRNA (Human)

Sign In for Pricing
View Details
CHPV M/Matrix protein Polyclonal Antibody
E55A05569 100 µg

CHPV M/Matrix protein Polyclonal Antibody

Sign In for Pricing
View Details
Lindane 2000 Î1⁄4g/mL in hexane: toluene (1:1)
CS-O-43248 1 Each

Lindane 2000 Î1⁄4g/mL in hexane: toluene (1:1)

Sign In for Pricing
View Details
ANXA6 Protein Vector (Mouse) (pPM-C-His)
PV154885 500 ng

ANXA6 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Prcc sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
37562116 3x 1.0 µg

Prcc sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details