Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD72, Human (Trx, His)

CD72 Protein plays a key role in orchestrating B-cell proliferation and differentiation, forming homodimers with disulfide linkages and interacting with CD5. It engages in tyrosine phosphorylation interactions with PTPN6/SHP-1, indicating its modulation of cellular responses through phosphorylation-based regulatory mechanisms. This underscores the multifaceted role of CD72 in the dynamic landscape of B-cell function and signaling. CD72 Protein, Human (N-Trx-6His) is the recombinant human-derived CD72 protein, expressed by E. coli , with N-Trx, N-His labeled tag.

Product Specifications

Product Name Alternative

CD72 Protein, Human (Trx, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd72-protein-human-n-trx-6his.html

Smiles

RYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTC

Molecular Formula

971 (Gene_ID) P21854 (R117-C226) (Accession)

Molecular Weight

Approximately 26-35 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SAP18 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
43010061 1.0 µg DNA

SAP18 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Ask
View Details
Bovine Complement factor B ELISA Kit
MBS2882841-01 48 Well

Bovine Complement factor B ELISA Kit

Ask
View Details
Bovine Complement factor B ELISA Kit
MBS2882841-02 96 Well

Bovine Complement factor B ELISA Kit

Ask
View Details
Bovine Complement factor B ELISA Kit
MBS2882841-03 5x 96 Well

Bovine Complement factor B ELISA Kit

Ask
View Details
Bovine Complement factor B ELISA Kit
MBS2882841-04 10x 96 Well

Bovine Complement factor B ELISA Kit

Ask
View Details
GPR101 rabbit pAb
ES2444-01 50 µL

GPR101 rabbit pAb

Ask
View Details