Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD72, Human (Trx, His)

CD72 Protein plays a key role in orchestrating B-cell proliferation and differentiation, forming homodimers with disulfide linkages and interacting with CD5. It engages in tyrosine phosphorylation interactions with PTPN6/SHP-1, indicating its modulation of cellular responses through phosphorylation-based regulatory mechanisms. This underscores the multifaceted role of CD72 in the dynamic landscape of B-cell function and signaling. CD72 Protein, Human (N-Trx-6His) is the recombinant human-derived CD72 protein, expressed by E. coli , with N-Trx, N-His labeled tag.

Product Specifications

Product Name Alternative

CD72 Protein, Human (Trx, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd72-protein-human-n-trx-6his.html

Smiles

RYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTC

Molecular Formula

971 (Gene_ID) P21854 (R117-C226) (Accession)

Molecular Weight

Approximately 26-35 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat Monoclonal IL-3R beta Antibody (130705) [DyLight 594]
FAB5492M 0.5 mL

Rat Monoclonal IL-3R beta Antibody (130705) [DyLight 594]

Ask
View Details
OB-cadherin (F-3) : m-IgG Fc BP-HRP Bundle
sc-525903 1 Kit

OB-cadherin (F-3) : m-IgG Fc BP-HRP Bundle

Ask
View Details
Alpha 1 acid glycoprotein 2 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-9915R-BF594 100 µL

Alpha 1 acid glycoprotein 2 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Ask
View Details
BMX Non Receptor Tyrosine Kinase Phospho-Tyr40 (BMX pY40) Antibody
abx326171-01 50 µg

BMX Non Receptor Tyrosine Kinase Phospho-Tyr40 (BMX pY40) Antibody

Ask
View Details
BMX Non Receptor Tyrosine Kinase Phospho-Tyr40 (BMX pY40) Antibody
abx326171-02 100 µg

BMX Non Receptor Tyrosine Kinase Phospho-Tyr40 (BMX pY40) Antibody

Ask
View Details
MIF (Macrophage Migration Inhibitory Factor, Glycosylation-inhibiting Factor, GIF, L-dopachrome Isomerase, L-dopachrome Tautomerase, Phenylpyruvate Tautomerase, GLIF, MMIF) (MaxLight 750) discontinued
129691-ML750 100 µL

MIF (Macrophage Migration Inhibitory Factor, Glycosylation-inhibiting Factor, GIF, L-dopachrome Isomerase, L-dopachrome Tautomerase, Phenylpyruvate Tautomerase, GLIF, MMIF) (MaxLight 750) discontinued

Ask
View Details