Aldose 1-epimerase/GALM, Human (His)
Aldose 1-epimerase/GALM Protein, Human (His) is a key enzyme of carbohydrate metabolism catalysing the interconversion of the alpha- and beta-anomers of hexose sugars such as glucose and galactose[1].
Product Specifications
Product Name Alternative
Aldose 1-epimerase/GALM Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/aldose-1-epimerase-galm-protein-human-his.html
Purity
98.0
Smiles
ASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVAHHHHHH
Molecular Formula
130589 (Gene_ID) Q96C23 (A2-A342) (Accession)
Molecular Weight
Approximately 38.0 kDa
References & Citations
[1]David J Timson, et al. Identification and characterisation of human aldose 1-epimerase. FEBS Lett. 2003 May 22;543 (1-3) :21-4.|[2]Tongkun Pai, et al. Galactomutarotase and other galactose-related genes are rapidly induced by retinoic acid in human myeloid cells. Biochemistry. 2007 Dec 25;46 (51) :15198-207.
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC471037-500 1x 500 µL
CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680031-100 1x 100 µL
Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
