Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aldose 1-epimerase/GALM, Human (His)

Aldose 1-epimerase/GALM Protein, Human (His) is a key enzyme of carbohydrate metabolism catalysing the interconversion of the alpha- and beta-anomers of hexose sugars such as glucose and galactose[1].

Product Specifications

Product Name Alternative

Aldose 1-epimerase/GALM Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/aldose-1-epimerase-galm-protein-human-his.html

Purity

98.0

Smiles

ASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVAHHHHHH

Molecular Formula

130589 (Gene_ID) Q96C23 (A2-A342) (Accession)

Molecular Weight

Approximately 38.0 kDa

References & Citations

[1]David J Timson, et al. Identification and characterisation of human aldose 1-epimerase. FEBS Lett. 2003 May 22;543 (1-3) :21-4.|[2]Tongkun Pai, et al. Galactomutarotase and other galactose-related genes are rapidly induced by retinoic acid in human myeloid cells. Biochemistry. 2007 Dec 25;46 (51) :15198-207.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp37 ORF Vector (Mouse) (pORF)
50944014 1.0 µg DNA

Zfp37 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Canine Serine/Threonine-Protein Kinase WNK1 (WNK1) ELISA Kit
MBS9939408-01 48 Well

Canine Serine/Threonine-Protein Kinase WNK1 (WNK1) ELISA Kit

Sign In for Pricing
View Details
Canine Serine/Threonine-Protein Kinase WNK1 (WNK1) ELISA Kit
MBS9939408-02 96 Well

Canine Serine/Threonine-Protein Kinase WNK1 (WNK1) ELISA Kit

Sign In for Pricing
View Details
Canine Serine/Threonine-Protein Kinase WNK1 (WNK1) ELISA Kit
MBS9939408-03 5x 96 Well

Canine Serine/Threonine-Protein Kinase WNK1 (WNK1) ELISA Kit

Sign In for Pricing
View Details
Canine Serine/Threonine-Protein Kinase WNK1 (WNK1) ELISA Kit
MBS9939408-04 10x 96 Well

Canine Serine/Threonine-Protein Kinase WNK1 (WNK1) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human RSC1A1 shRNA (UAS) - Lentiviral human RSC1A1 shRNA (UAS, iRFP) (25)
GTR15122306 1 Vial

Lentiviral human RSC1A1 shRNA (UAS) - Lentiviral human RSC1A1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details