Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein GOLM2 (GOLM2), partial

Product Specifications

Product Name Alternative

(Cancer susceptibility candidate gene 4 protein) (CASC4) (Golgi membrane protein 2)

Abbreviation

Recombinant Human GOLM2 protein, partial

Gene Name

GOLM2

UniProt

Q6P4E1

Expression Region

36-436aa

Organism

Homo sapiens (Human)

Target Sequence

SSRHVLLQEEVAELQGQVQRTEVARGRLEKRNSDLLLLVDTHKKQIDQKEADYGRLSSRLQAREGLGKRCEDDKVKLQNNISYQMADIHHLKEQLAELRQEFLRQEDQLQDYRKNNTYLVKRLEYESFQCGQQMKELRAQHEENIKKLADQFLEEQKQETQKIQSNDGKELDINNQVVPKNIPKVAENVADKNEEPSSNHIPHGKEQIKRGGDAGMPGIEENDLAKVDDLPPALRKPPISVSQHESHQAISHLPTGQPLSPNMPPDSHINHNGNPGTSKQNPSSPLQRLIPGSNLDSEPRIQTDILKQATKDRVSDFHKLKQSRFFDENESPVDPQHGSKLADYNGDDGNVGEYEADKQAELAYNEEEDGDGGEEDVQDDEERELQMDPADYGKQHFNDVL

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Tags & Cell Markers

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

53.1 kDa

References & Citations

"Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S. Nat. Genet. 36:40-45 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Persephin (PSPN)
FY-AB47412-01 1 mL

Anti-Persephin (PSPN)

Sign In for Pricing
View Details
Anti-Persephin (PSPN)
FY-AB47412-02 100 µL

Anti-Persephin (PSPN)

Sign In for Pricing
View Details
Anti-Persephin (PSPN)
FY-AB47412-03 200 µL

Anti-Persephin (PSPN)

Sign In for Pricing
View Details
Dysprosium Rod 12.5 mm diameter, 99.9%
GX6568-50mm 50 mm

Dysprosium Rod 12.5 mm diameter, 99.9%

Sign In for Pricing
View Details
HRP Linked Monoclonal Antibody to Annexin A1 (ANXA1)
MBS2136608-01 0.1 mL

HRP Linked Monoclonal Antibody to Annexin A1 (ANXA1)

Sign In for Pricing
View Details
HRP Linked Monoclonal Antibody to Annexin A1 (ANXA1)
MBS2136608-02 0.2 mL

HRP Linked Monoclonal Antibody to Annexin A1 (ANXA1)

Sign In for Pricing
View Details