Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Complement C1s-1 subcomponent (C1s1)

Product Specifications

Product Name Alternative

(C1 esterase) (Complement component 1 subcomponent s-A)

Abbreviation

Recombinant Mouse C1s1 protein

Gene Name

C1s1

UniProt

Q8CG14

Expression Region

16-688aa

Organism

Mus musculus (Mouse)

Target Sequence

EPTMHGEILSPNYPQAYPNDVVKSWDIEVPEGFGIHLYFTHVDIEPSESCAYDSVQIISGGIEEGRLCGQKTSKSPNSPIIEEFQFPYNKLQVVFTSDFSNEERFTGFAAYYTAIDINECTDFTDVPCSHFCNNFIGGYFCSCPPEYFLHDDMRNCGVNCSGDVFTALIGEISSPNYPNPYPENSRCEYQIQLQEGFQVVVTMQREDFDVEPADSEGNCPDSLTFASKNQQFGPYCGNGFPGPLTIRTQSNTLGIVFQTDLMGQKKGWKLRYHGDPISCAKKITANSTWEPDKAKYVFKDVVKITCVDGFEVVEGHVSSTSYYSTCQSDGQWSNSGLKCQPVYCGIPDPIANGKVEEPENSVFGTVVHYTCEEPYYYMEHEEGGEYRCAANGRWVNDQLGIELPRCIPACGVPTEPFQVHQRIFGGQPAKIENFPWQVFFNHPRASGALINEYWVLTAAHVLEKISDPLMYVGTMSVRTTLLENAQRLYSKRVFIHPSWKKEDDPNTRTNFDNDIALVQLKDPVKMGPKVSPICLPGTSSEYNVSPGDMGLISGWGSTEKKVFVINLRGAKVPVTSLETCKQVKEENPTVRPEDYVFTDNMICAGEKGVDSCHGDSGGAFAFQVPNVTVPKFYVAGLVSWGKRCGTYGVYTKVKNYVDWILKTMQENSGPRKD

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Others

Relevance

C1s B chain is a serine protease that combines with C1q and C1r to form C1, the first component of the classical pathway of the complement system. C1r activates C1s so that it can, in turn, activate C2 and C4.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

77.4 kDa

References & Citations

"Complement C1r and C1s genes are duplicated in the mouse: differential expression generates alternative isomorphs in the liver and in the male reproductive system." Garnier G., Circolo A., Xu Y., Volanakis J.E. Biochem. J. 371:631-640 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPG2 siRNA (Human)
orb1865982-01 15 nmol

HSPG2 siRNA (Human)

Sign In for Pricing
View Details
HSPG2 siRNA (Human)
orb1865982-02 30 nmol

HSPG2 siRNA (Human)

Sign In for Pricing
View Details
Human Nicotinic Acetylcholine Receptor (AChRs) ELISA Kit
MBS3801894-01 48 Well

Human Nicotinic Acetylcholine Receptor (AChRs) ELISA Kit

Sign In for Pricing
View Details
Human Nicotinic Acetylcholine Receptor (AChRs) ELISA Kit
MBS3801894-02 96 Well

Human Nicotinic Acetylcholine Receptor (AChRs) ELISA Kit

Sign In for Pricing
View Details
Human Nicotinic Acetylcholine Receptor (AChRs) ELISA Kit
MBS3801894-03 5x 96 Well

Human Nicotinic Acetylcholine Receptor (AChRs) ELISA Kit

Sign In for Pricing
View Details
Human Nicotinic Acetylcholine Receptor (AChRs) ELISA Kit
MBS3801894-04 10x 96 Well

Human Nicotinic Acetylcholine Receptor (AChRs) ELISA Kit

Sign In for Pricing
View Details