Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Sortase A (srtA) , partial (P94R, D160N, D165A, K190E, K196T, D124G, Y187L, E189R)

Product Specifications

CAS Number

9000-83-3

Gene Name

srtA

UniProt

Q2FV99

Expression Region

25-206aa (P94R, D160N, D165A, K190E, K196T, D124G, Y187L, E189R)

Organism

Staphylococcus aureus (strain NCTC 8325)

Target Sequence

AKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATREQLNRGVSFAEENESLDDQNISIAGHTFIGRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRNVKPTAVGVLDEQKGKDKQLTLITCDDLNRETGVWETRKIFVATEVK

Tag

N-terminal 6xHis-tagged

Source

Yeast

Field of Research

Microbiology

Assay Type

Developed Protein

Relevance

Transpeptidase that anchors surface proteins to the cell wall . Recognizes and modifies its substrate by proteolytic cleavage of a C-terminal sorting signal.

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Length

Partial

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL
BNC050391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL
BNC740177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF568 conjugate, 0.1mg/mL
BNC681045-500 1x 500 µL

CD16 (C16/1045), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL
BNC402853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF594 conjugate, 0.1mg/mL
BNC940645-100 1x 100 µL

FOXP3 (3G3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF488A conjugate, 0.1mg/mL
BNC880160-500 1x 500 µL

CD20 (B9E9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details