Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free AITRL/TNFSF18, Human (His)

Selected Variant

HY-P700014AF-01

Size: 2 µg

AITRL, a type II transmembrane protein, is a ligand for glucocorticoid-induced TNFR-related protein (GITR) . When AITRL binds to GITR, GITR can produce costimulatory signals that regulate T-cell proliferation and effector functions. GITR/AITRL interaction plays a role in the pathogenesis of tumor, inflammation, as well as autoimmune diseases[1]. Besides, AITRL plays a role in endothelial cells (EC) -activation and increases STAT-1 phosphorylation and the expression of adhesion molecules (VCAM-1, ICAM-1) [2]. Animal-Free AITRL/TNFSF18 Protein, Human (His) is a recombinant human AITRL (Q49-I174) with C-terminal His tag, which is expressed in E.coli.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free AITRL/TNFSF18 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-aitrl-tnfsf18-protein-human-his.html

Purity

95.0

Smiles

MQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILIANPQEI

Molecular Formula

8995 (Gene_ID) Q9UNG2 (Q49-I174) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Tian J, et al. The Role of GITR/GITRL Interaction in Autoimmune Diseases. Front Immunol. 2020 Oct 9;11:588682.|[2]Lacal PM, et al. Glucocorticoid-induced tumor necrosis factor receptor family-related ligand triggering upregulates vascular cell adhesion molecule-1 and intercellular adhesion molecule-1 and promotes leukocyte adhesion. J Pharmacol Exp Ther. 2013 Oct;347 (1) :164-72.|[3]Wang F, et al. Structures of mouse and human GITR-GITRL complexes reveal unique TNF superfamily interactions. Nat Commun. 2021 Mar 2;12 (1) :1378.|[4]Placke T, et al. Glucocorticoid-induced TNFR-related (GITR) protein and its ligand in antitumor immunity: functional role and therapeutic modulation. Clin Dev Immunol. 2010;2010:239083.|[5]Tian J, et al. Increased GITRL Impairs the Function of Myeloid-Derived Suppressor Cells and Exacerbates Primary Sjögren Syndrome. J Immunol. 2019 Mar 15;202 (6) :1693-1703.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Price

Sign In for Pricing

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D205), CF640R conjugate, 0.1mg/mL
BNC400205-500 1x 500 µL

Complement C4d (C4D205), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti-GCSF Receptor/CSF3R Antibody Picoband®
PA1906 100 µg/Vial

Anti-GCSF Receptor/CSF3R Antibody Picoband®

Sign In for Pricing
View Details
Anti-Desmoglein 2/DSG2 Antibody Picoband®, iFluor647 Conjugate
PA1559-iFluor647 100 µg

Anti-Desmoglein 2/DSG2 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
HSP60 (GROEL/730), 1mg/mL
BNUM0730-50 1x 50 µL

HSP60 (GROEL/730), 1mg/mL

Sign In for Pricing
View Details
Lamin B Receptor / LBR Recombinant Rabbit Monoclonal Antibody [PSH02-93]
HA721912 100 µL

Lamin B Receptor / LBR Recombinant Rabbit Monoclonal Antibody [PSH02-93]

Sign In for Pricing
View Details
Cytokeratin 18 (C-04), CF740 conjugate, 0.1mg/mL
BNC740041-500 1x 500 µL

Cytokeratin 18 (C-04), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details