Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Erythropoietin receptor (Epor), partial

Product Specifications

Product Name Alternative

Epor; Erythropoietin receptor; EPO-R

Abbreviation

Recombinant Rat Epor protein, partial

Gene Name

Epor

UniProt

Q07303

Expression Region

25-249aa

Organism

Rattus norvegicus (Rat)

Target Sequence

ASSPSLPDPKFESKAALLASRGSEELLCFTQRLEDLVCFWEEAANSGMGFNYSFSYQLEGESRKSCRLHQAPTVRGSMRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYEVDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPASLLTASDLDP

Tag

N-terminal 6xHis-SUMO-tagged and C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Receptor for erythropoietin. Mediates erythropoietin-induced erythroblast proliferation and differentiation. Upon EPO stimulation, EPOR dimerizes triggering the JAK2/STAT5 signaling cascade. In some cell types, can also activate STAT1 and STAT3. May also activate LYN tyrosine kinase (By similarity) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.1 kDa

References & Citations

"Functional erythropoietin receptor of the cells with neural characteristics. Comparison with receptor properties of erythroid cells." Masuda S., Nagao M., Takahata K., Konishi Y., Gallyas F., Tabira T., Sasaki R. J. Biol. Chem. 268:11208-11216 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS2 Protein Vector (Human) (pPB-C-His)
PV036813 500 ng

SARS2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Rabbit Monoclonal CD8 alpha Antibody (YTS 105.18) [Alexa Fluor 647]
NBP2-52659AF647 0.1 mL

Rabbit Monoclonal CD8 alpha Antibody (YTS 105.18) [Alexa Fluor 647]

Sign In for Pricing
View Details
ITCH/AIP4 Rabbit Polyclonal Antibody (Fluoro647)
orb3119584 100 µg

ITCH/AIP4 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Creatine Phosphokinase (2ba6), CF405S conjugate, 0.1mg/mL
BNC040196-100 1x 100 µL

Creatine Phosphokinase (2ba6), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Parm1 Mouse Gene Knockout Kit (CRISPR)
KN512817 1 Kit

Parm1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RN5S276 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV744437 1.0 µg DNA

RN5S276 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details