Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACVR2B, Human/Cynomolgus (P. pastoris, N-His)

ACVR2B is a transmembrane kinase that forms the activin receptor complex and is essential for transducing activin signals. It regulates diverse processes including neuronal differentiation, hair follicle development, FSH production, wound healing, matrix production, immunosuppression, and carcinogenesis. ACVR2B Protein, Human/Cynomolgus (P. pastoris, N-His) is the recombinant human-derived ACVR2B protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ACVR2B Protein, Human/Cynomolgus (P. pastoris, N-His), Human; Cynomolgus, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/acvr2b-protein-human-p-pastoris-n-his.html

Smiles

SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTLLT

Molecular Formula

93/102118668 (Gene_ID) Q13705-1 (S19-T137) /XP_045242398.1 (S40-T158) (Accession)

Molecular Weight

15.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ARHGEF1 Antibody [Alexa Fluor 488]
NBP1-46831AF488 0.1 mL

Rabbit Polyclonal ARHGEF1 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
Rabbit Monoclonal Pax2 Antibody (PAX2/8671R) [HRP]
NBP3-20755H 0.1 mL

Rabbit Monoclonal Pax2 Antibody (PAX2/8671R) [HRP]

Sign In for Pricing
View Details
TNFRSF17 (Tumor Necrosis Factor Receptor Superfamily Member 17, B Cell Maturation Protein, BCM, BCMA, CD269) (HRP)
134541-HRP 100 µL

TNFRSF17 (Tumor Necrosis Factor Receptor Superfamily Member 17, B Cell Maturation Protein, BCM, BCMA, CD269) (HRP)

Sign In for Pricing
View Details
HGD (Homogentisate 1,2-dioxygenase (Homogentisate Oxidase), AKU, HGO) (MaxLight 750) discontinued
247058-ML750 100 µL

HGD (Homogentisate 1,2-dioxygenase (Homogentisate Oxidase), AKU, HGO) (MaxLight 750) discontinued

Sign In for Pricing
View Details
CREBBP (HRP)
559368-01 50 µg

CREBBP (HRP)

Sign In for Pricing
View Details
CREBBP (HRP)
559368-02 100 µg

CREBBP (HRP)

Sign In for Pricing
View Details