Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACVR2B, Human/Cynomolgus (P. pastoris, N-His)

ACVR2B is a transmembrane kinase that forms the activin receptor complex and is essential for transducing activin signals. It regulates diverse processes including neuronal differentiation, hair follicle development, FSH production, wound healing, matrix production, immunosuppression, and carcinogenesis. ACVR2B Protein, Human/Cynomolgus (P. pastoris, N-His) is the recombinant human-derived ACVR2B protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ACVR2B Protein, Human/Cynomolgus (P. pastoris, N-His), Human; Cynomolgus, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/acvr2b-protein-human-p-pastoris-n-his.html

Smiles

SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTLLT

Molecular Formula

93/102118668 (Gene_ID) Q13705-1 (S19-T137) /XP_045242398.1 (S40-T158) (Accession)

Molecular Weight

15.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Circovirus 2 PCV2 antibody ELISA Kit
E30051 96 Tests

Porcine Circovirus 2 PCV2 antibody ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal OR2F1 Antibody
NBP3-09391-100ul 100 µL

Rabbit Polyclonal OR2F1 Antibody

Sign In for Pricing
View Details
FAM117A (NM_030802) Human 3' UTR Clone
SC211333 10 µg

FAM117A (NM_030802) Human 3' UTR Clone

Sign In for Pricing
View Details
CD39 Antibody
MBS8583847-01 0.1 mL

CD39 Antibody

Sign In for Pricing
View Details
CD39 Antibody
MBS8583847-02 0.1 mL (AF635)

CD39 Antibody

Sign In for Pricing
View Details
CD39 Antibody
MBS8583847-03 0.1 mL (AF610)

CD39 Antibody

Sign In for Pricing
View Details