Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPPB, Human (76a.a, Flag-His)

NPPB proteins are members of the natriuretic peptide family and are key regulators of cardiovascular homeostasis. As a hormone, NPPB is produced and released primarily by ventricular myocytes in response to increases in pressure and volume. NPPB Protein, Human (76a.a, Flag-His) is the recombinant human-derived NPPB protein, expressed by E. coli , with N-6*His, N-Flag labeled tag.

Product Specifications

Product Name Alternative

NPPB Protein, Human (76a.a, Flag-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nppb-protein-human-76a-a-flag-his.html

Purity

98.0

Smiles

HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR

Molecular Formula

4879 (Gene_ID) P16860 (H27-R102) (Accession)

Molecular Weight

Approximately 14.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAPNS1 Human Knockdown Lysate
LY300085 100 µg

CAPNS1 Human Knockdown Lysate

Sign In for Pricing
View Details
Rat Lymphocyte Function Associated Antigen 1 Alpha (LFA1a) ELISA Kit
RDR-LFA1a-Ra-01 96 Tests

Rat Lymphocyte Function Associated Antigen 1 Alpha (LFA1a) ELISA Kit

Sign In for Pricing
View Details
Rat Lymphocyte Function Associated Antigen 1 Alpha (LFA1a) ELISA Kit
RDR-LFA1a-Ra-02 48 Tests

Rat Lymphocyte Function Associated Antigen 1 Alpha (LFA1a) ELISA Kit

Sign In for Pricing
View Details
CHRAC1 Rabbit Polyclonal Antibody
TA374760 100 µL

CHRAC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PBOV1 Human Gene Knockout Kit (CRISPR)
KN424543 1 Kit

PBOV1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Amino-4-chloro-5-nitropyridine
TRC-A603487-250MG 250 mg

2-Amino-4-chloro-5-nitropyridine

Sign In for Pricing
View Details