Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPPB, Human (76a.a, Flag-His)

NPPB proteins are members of the natriuretic peptide family and are key regulators of cardiovascular homeostasis. As a hormone, NPPB is produced and released primarily by ventricular myocytes in response to increases in pressure and volume. NPPB Protein, Human (76a.a, Flag-His) is the recombinant human-derived NPPB protein, expressed by E. coli , with N-6*His, N-Flag labeled tag.

Product Specifications

Product Name Alternative

NPPB Protein, Human (76a.a, Flag-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nppb-protein-human-76a-a-flag-his.html

Purity

98.0

Smiles

HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR

Molecular Formula

4879 (Gene_ID) P16860 (H27-R102) (Accession)

Molecular Weight

Approximately 14.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CACNA1B antibody
STJ119111 100 µl

Anti-CACNA1B antibody

Sign In for Pricing
View Details
Rabbit Monoclonal Dopa Decarboxylase/DDC Antibody (040) [Alexa Fluor 647]
NBP2-89567AF647 0.1 mL

Rabbit Monoclonal Dopa Decarboxylase/DDC Antibody (040) [Alexa Fluor 647]

Sign In for Pricing
View Details
Chinfloxacin
HY-123175 1 Each

Chinfloxacin

Sign In for Pricing
View Details
HNF3-alpha/FOXA1 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-8634R-BF647 100 µL

HNF3-alpha/FOXA1 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Bovine Enolase 2; Neuron-specific enolase, NSE; ENO2 ELISA KIT
E0437Bo-01 48 Well

Bovine Enolase 2; Neuron-specific enolase, NSE; ENO2 ELISA KIT

Sign In for Pricing
View Details
Bovine Enolase 2; Neuron-specific enolase, NSE; ENO2 ELISA KIT
E0437Bo-02 96 Well

Bovine Enolase 2; Neuron-specific enolase, NSE; ENO2 ELISA KIT

Sign In for Pricing
View Details