Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-gamma, Sheep (His)

IFN-gamma (interferon-gamma) is a type II interferon produced by T cells and NK cells, which can significantly activate antibacterial, antiviral and antitumor responses. It acts through the JAK-STAT pathway and its receptor IFNGR1 to affect gene regulation. IFN-gamma Protein, Sheep (His) is the recombinant sheep-derived IFN-gamma protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IFN-gamma Protein, Sheep (His), Sheep, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-gamma-protein-sheep-his.html

Purity

93.00

Smiles

QGPFFKEIENLKEYFNASNPDVAKGGPLFSEILKNWKEESDKKIIQSQIVSFYFKLFENLKDNQVIQRSMDIIKQDMFQKFLNGSSEKLEDFKRLIQIPVDDLQIQRKAINELIKVMNDLSPKSNLRKRKRSQNLFRGRRASM

Molecular Formula

443396 (Gene_ID) P17773 (Q24-M166) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Liver
CR562705 5 µg

Tissue Total RNA, Liver

Sign In for Pricing
View Details
PPAR alpha (PPARA) Mouse Monoclonal Antibody [Clone:1E8]
E45M11754 100 µg

PPAR alpha (PPARA) Mouse Monoclonal Antibody [Clone:1E8]

Sign In for Pricing
View Details
KMCP1 CRISPR Activation Plasmid (m)
sc-426623-ACT 20 µg

KMCP1 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
PTPa, NT (Receptor-type Tyrosine-protein Phosphatase alpha, Protein-tyrosine Phosphatase alpha, R-PTP-alpha, PTPRA, PTPRL2) (Biotin)
MBS6495699-01 0.2 mL

PTPa, NT (Receptor-type Tyrosine-protein Phosphatase alpha, Protein-tyrosine Phosphatase alpha, R-PTP-alpha, PTPRA, PTPRL2) (Biotin)

Sign In for Pricing
View Details
PTPa, NT (Receptor-type Tyrosine-protein Phosphatase alpha, Protein-tyrosine Phosphatase alpha, R-PTP-alpha, PTPRA, PTPRL2) (Biotin)
MBS6495699-02 5x 0.2 mL

PTPa, NT (Receptor-type Tyrosine-protein Phosphatase alpha, Protein-tyrosine Phosphatase alpha, R-PTP-alpha, PTPRA, PTPRL2) (Biotin)

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) EDC2 Polyclonal Antibody
MBS7158582 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) EDC2 Polyclonal Antibody

Sign In for Pricing
View Details