Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GABARBP (GABA-Receptor B Associated Protein) ELISA Kit

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human GABARBP. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human GABARBP. Next, Avidin conjugated to Horseradish Peroxidase (HRP) is added to each microplate well and incubated. After TMB substrate solution is added, only those wells that contain Human GABARBP, biotin-conjugated antibody and enzyme-conjugated Avidin will exhibit a change in color. The enzyme-substrate reaction is terminated by the addition of sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450nm ± 10nm. The concentration of Human GABARBP in the samples is then determined by comparing the OD of the samples to the standard curve.

Product Specifications

Product Name Alternative

GABARBP

Reactivity

Human

Field of Research

Signal transduction

Assay Type

Sandwich

Assay Principle

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human GABARBP. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human GABARBP. Next, Avidin conjugated to Horseradish Peroxidase (HRP) is added to each microplate well and incubated. After TMB substrate solution is added, only those wells that contain Human GABARBP, biotin-conjugated antibody and enzyme-conjugated Avidin will exhibit a change in color. The enzyme-substrate reaction is terminated by the addition of sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450nm ± 10nm. The concentration of Human GABARBP in the samples is then determined by comparing the OD of the samples to the standard curve.

Assay Performance Time

3.5h

Standard

10 ng/mL

Sample Type

Tissue homogenates, cell lysates and other biological fluids.

Detection Range

0.16-10 ng/mL

Sensitivity

0.065 ng/mL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PMCA1 Rabbit Monoclonal Antibody
MBS1757089-01 0.03 mL

Anti-PMCA1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-PMCA1 Rabbit Monoclonal Antibody
MBS1757089-02 0.1 mL

Anti-PMCA1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-PMCA1 Rabbit Monoclonal Antibody
MBS1757089-03 5x 0.1 mL

Anti-PMCA1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
HY-P1229-01 5 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
HY-P1229-02 10 mg

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Sign In for Pricing
View Details
Rat acetylcholine receptor antibody (AChRab) ELISA Kit
GA-E0731RT-01 48 Tests

Rat acetylcholine receptor antibody (AChRab) ELISA Kit

Sign In for Pricing
View Details