Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free TGF alpha/TGFA, Human (His)

TGF α/TGFA protein is a mitogenic polypeptide that binds to EGFR and acts synergistically with TGF β to promote anchorage-dependent cell proliferation. Its interaction with MAGI3, SDCBP, and the SNTA1 PDZ domain, especially with SDCBP, is critical for efficient cell surface targeting. Animal-Free TGF alpha/TGFA Protein, Human (His) is the recombinant human-derived animal-FreeTGF alpha/TGFA protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free TGF alpha/TGFA Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-tgf-alpha-tgfa-protein-human-his.html

Purity

98.0

Smiles

MVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA

Molecular Formula

7039 (Gene_ID) P01135 (V40-A89) (Accession)

Molecular Weight

Approximately 7-9 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD344/FZD4 Protein, His Tag
E40KMH481 20 µg

Recombinant Human CD344/FZD4 Protein, His Tag

Sign In for Pricing
View Details
Ifenprodil hemitartrate
sc-203601A 50 mg

Ifenprodil hemitartrate

Sign In for Pricing
View Details
Mouse Monoclonal Pref-1/DLK1/FA1 Antibody (PF13-3) [mFluor Violet 500 SE]
NBP2-80046MFV500 0.1 mL

Mouse Monoclonal Pref-1/DLK1/FA1 Antibody (PF13-3) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Rat Monoclonal CCL20/MIP-3 alpha Antibody (114906) [HRP]
FAB760H 0.1 mL

Rat Monoclonal CCL20/MIP-3 alpha Antibody (114906) [HRP]

Sign In for Pricing
View Details
ALS2CL (NM_147129) Human Untagged Clone
SC100256 10 µg

ALS2CL (NM_147129) Human Untagged Clone

Sign In for Pricing
View Details
GNAI3 Antibody
MBS9605562-01 0.1 mL

GNAI3 Antibody

Sign In for Pricing
View Details