Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pro-epidermal growth factor (EGF), partial

Product Specifications

Product Name Alternative

EGF; Urogastrone

Abbreviation

Recombinant Human EGF protein, partial

Gene Name

EGF

UniProt

P01133

Expression Region

971-1023aa

Organism

Homo sapiens (Human)

Target Sequence

NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Tag

Tag-Free

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6. Can induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

6.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal PXR/NR1I2 Antibody (V11P4G11/E7) [DyLight 350]
NBP2-50519UV 0.1 mL

Mouse Monoclonal PXR/NR1I2 Antibody (V11P4G11/E7) [DyLight 350]

Sign In for Pricing
View Details
S Protein Rabbit Monoclonal Antibody [Clone ID: OTIR4D11]
TA592334 100 µL

S Protein Rabbit Monoclonal Antibody [Clone ID: OTIR4D11]

Sign In for Pricing
View Details
PLEKHF2, ID (PLEKHF2, ZFYVE18, Pleckstrin homology domain-containing family F member 2, PH and FYVE domain-containing protein 2, Phafin-2, Zinc finger FYVE domain-containing protein 18)
MBS647305-01 0.2 mL

PLEKHF2, ID (PLEKHF2, ZFYVE18, Pleckstrin homology domain-containing family F member 2, PH and FYVE domain-containing protein 2, Phafin-2, Zinc finger FYVE domain-containing protein 18)

Sign In for Pricing
View Details
PLEKHF2, ID (PLEKHF2, ZFYVE18, Pleckstrin homology domain-containing family F member 2, PH and FYVE domain-containing protein 2, Phafin-2, Zinc finger FYVE domain-containing protein 18)
MBS647305-02 5x 0.2 mL

PLEKHF2, ID (PLEKHF2, ZFYVE18, Pleckstrin homology domain-containing family F member 2, PH and FYVE domain-containing protein 2, Phafin-2, Zinc finger FYVE domain-containing protein 18)

Sign In for Pricing
View Details
DOK1 AAV Vector (Rat) (CMV)
18506106 1 µg

DOK1 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
GFP Monoclonal Antibody (Mix)
RA10523-01 50 µL

GFP Monoclonal Antibody (Mix)

Sign In for Pricing
View Details