Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galectin-3/LGALS3, Mouse (HEK293, His)

Galectin-3/LGALS3 protein binds IgE and cooperates with integrins α-3 and β-1 to promote endothelial cell migration.It contributes to epithelial cell differentiation and acts as a splicing factor in the nucleus.Galectin-3/LGALS3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Galectin-3/LGALS3 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Galectin-3/LGALS3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/galectin-3-lgals3-protein-mouse-hek293-his.html

Purity

96.00

Smiles

ADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPGAYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGQPAPGAFPGQPGAPGAYPQCSGGYPAAGPYGVPAGPLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNENNRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITLTSANHAMI

Molecular Formula

16854 (Gene_ID) P16110 (A2-I264) (Accession)

Molecular Weight

Approximately 35-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FZD10 discontinued
389337 200 µL

FZD10 discontinued

Sign In for Pricing
View Details
Plakophilin 3 discontinued
512866 100 µg

Plakophilin 3 discontinued

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Tubulin Delta (TUBd)
MBS2075191-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Tubulin Delta (TUBd)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Tubulin Delta (TUBd)
MBS2075191-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Tubulin Delta (TUBd)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Tubulin Delta (TUBd)
MBS2075191-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Tubulin Delta (TUBd)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Tubulin Delta (TUBd)
MBS2075191-04 1 mL

APC/CY7-Linked Polyclonal Antibody to Tubulin Delta (TUBd)

Sign In for Pricing
View Details