Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGS17, Human (GST)

RGS17 protein centrally regulates G protein-coupled receptor signaling and inhibits signal transduction by enhancing the activity of G protein α subunit GTPase.It selectively binds to GNAZ and GNAI2 subunits, accelerates GTPase activity and regulates signaling.RGS17 Protein, Human (GST) is the recombinant human-derived RGS17 protein, expressed by E.coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

RGS17 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rgs17-protein-human-gst.html

Smiles

MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES

Molecular Formula

26575 (Gene_ID) Q9UGC6 (M1-S210) (Accession)

Molecular Weight

51.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLC1D CRISPR All-in-one AAV vector set (with saCas9)(Human)
21578151 3x 1.0 µg DNA

GLC1D CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Hnrph1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
23771066 1.0 µg DNA

Hnrph1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Lentiviral human RSPO3 shRNA (UAS) - Lentiviral human RSPO3 shRNA (UAS, GFP) (100)
GTR15353592 1 Vial

Lentiviral human RSPO3 shRNA (UAS) - Lentiviral human RSPO3 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
PRCD (NM_001077620) Human Recombinant Protein
PH35595M5 20 µg

PRCD (NM_001077620) Human Recombinant Protein

Sign In for Pricing
View Details
Human CD134/TNFRSF4/OX40 Monoclonal Antibody
orb3152691-01 50 µg

Human CD134/TNFRSF4/OX40 Monoclonal Antibody

Sign In for Pricing
View Details
Human CD134/TNFRSF4/OX40 Monoclonal Antibody
orb3152691-02 100 µg

Human CD134/TNFRSF4/OX40 Monoclonal Antibody

Sign In for Pricing
View Details