Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGS17, Human (GST)

RGS17 protein centrally regulates G protein-coupled receptor signaling and inhibits signal transduction by enhancing the activity of G protein α subunit GTPase.It selectively binds to GNAZ and GNAI2 subunits, accelerates GTPase activity and regulates signaling.RGS17 Protein, Human (GST) is the recombinant human-derived RGS17 protein, expressed by E.coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

RGS17 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rgs17-protein-human-gst.html

Smiles

MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES

Molecular Formula

26575 (Gene_ID) Q9UGC6 (M1-S210) (Accession)

Molecular Weight

51.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRAP Antibody, FITC conjugated
A54963-50UL 50 μL

GRAP Antibody, FITC conjugated

Sign In for Pricing
View Details
BAD (NM_004322) Human Recombinant Protein
TP300634 20 µg

BAD (NM_004322) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Or6c74 qPCR Primer Pair
QM67014S 200 Tests

Mouse Or6c74 qPCR Primer Pair

Sign In for Pricing
View Details
C17orf97 Protein Vector (Human) (pPM-N-D-C-His)
PV329449 500 ng

C17orf97 Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details
Klhl10 Rat siRNA Oligo Duplex (Locus ID 303533)
SR501576 1 Kit

Klhl10 Rat siRNA Oligo Duplex (Locus ID 303533)

Sign In for Pricing
View Details
Mouse BEN domain containing protein 3 (BEND3) ELISA Kit
GTR10353927 96 Well

Mouse BEN domain containing protein 3 (BEND3) ELISA Kit

Sign In for Pricing
View Details