RGS17, Human (GST)
RGS17 protein centrally regulates G protein-coupled receptor signaling and inhibits signal transduction by enhancing the activity of G protein α subunit GTPase.It selectively binds to GNAZ and GNAI2 subunits, accelerates GTPase activity and regulates signaling.RGS17 Protein, Human (GST) is the recombinant human-derived RGS17 protein, expressed by E.coli , with N-GST labeled tag.
Product Specifications
Product Name Alternative
RGS17 Protein, Human (GST), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/rgs17-protein-human-gst.html
Smiles
MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES
Molecular Formula
26575 (Gene_ID) Q9UGC6 (M1-S210) (Accession)
Molecular Weight
51.4 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
MBS6250634-01 0.1 mL
CD49d (Antigen CD49d, CD49d Antigen, CDw49d, Alpha 4 Subunit of VLA-4 Receptor, Integrin alpha IV, Integrin alpha 4, IA4, ITGA4, LPAM23, MGC90518, Very Late Activation Protein 4 Receptor Alpha 4 Subunit, VLA4, VLA-4) (HRP)
Ask
View Details 
MBS6250634-02 5x 0.1 mL
CD49d (Antigen CD49d, CD49d Antigen, CDw49d, Alpha 4 Subunit of VLA-4 Receptor, Integrin alpha IV, Integrin alpha 4, IA4, ITGA4, LPAM23, MGC90518, Very Late Activation Protein 4 Receptor Alpha 4 Subunit, VLA4, VLA-4) (HRP)
Ask
View Details 