CALML3, Human (GST)
The CALML3 protein has a dual role, acting as a specific light chain of unconventional myosin 10 (MYO10) and enhancing MYO10 translation. CALML3 has a potential molecular chaperone role and contributes to the synthesis of the emerging MYO10 heavy chain protein. CALML3 Protein, Human (GST) is the recombinant human-derived CALML3 protein, expressed by E. coli , with N-GST labeled tag.
Product Specifications
Product Name Alternative
CALML3 Protein, Human (GST), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/calml3-protein-human-gst.html
Smiles
MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK
Molecular Formula
810 (Gene_ID) P27482 (M1-K149) (Accession)
Molecular Weight
Approximately 43.9 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
Recombinant Erwinia carotovora subsp. atroseptica Macrolide export ATP-binding/permease protein MacB (macB)
Recombinant Erwinia carotovora subsp. atroseptica Macrolide export ATP-binding/permease protein MacB (macB)