Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP, Human (HEK293, hFc)

The GIP protein is a member of the glucagon superfamily, an important incretin hormone that stimulates pancreatic beta cells to secrete insulin in response to food intake. Through its G protein-coupled receptor, it activates adenylyl cyclase and other signal transduction pathways. GIP Protein, Human (HEK293, hFc) is the recombinant human-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

GIP Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gip-protein-human-hek293-fc-solution.html

Purity

98.0

Smiles

EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Molecular Formula

2695 (Gene_ID) NP_004114.1 (E22-Q93) (Accession)

Molecular Weight

Approximately 37-48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CBR3 shRNA (UAS) - Lentiviral human CBR3 shRNA (UAS, RFP) (25)
GTR15091271 1 Vial

Lentiviral human CBR3 shRNA (UAS) - Lentiviral human CBR3 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Recombinant Mouse CCDC151 Protein, His (Fc)-Avi-tagged
CCDC151-1316M 50 µg

Recombinant Mouse CCDC151 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Oct-2 (POU2F2) (NM_002698) Human Tagged Lenti ORF Clone
RC216813L3 10 µg

Oct-2 (POU2F2) (NM_002698) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal SLC35E1 Antibody [mFluor Violet 610 SE]
NBP2-97796MFV610 0.1 mL

Rabbit Polyclonal SLC35E1 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Bovine Free Protein S (fPS) ELISA Kit
NSL0270Bo 96 Tests

Bovine Free Protein S (fPS) ELISA Kit

Sign In for Pricing
View Details
March5 sgRNA CRISPR Lentivector set (Mouse)
K4102401 3x 1.0 µg

March5 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details