Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP, Human (HEK293, hFc)

The GIP protein is a member of the glucagon superfamily, an important incretin hormone that stimulates pancreatic beta cells to secrete insulin in response to food intake. Through its G protein-coupled receptor, it activates adenylyl cyclase and other signal transduction pathways. GIP Protein, Human (HEK293, hFc) is the recombinant human-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

GIP Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gip-protein-human-hek293-fc-solution.html

Purity

98.0

Smiles

EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Molecular Formula

2695 (Gene_ID) NP_004114.1 (E22-Q93) (Accession)

Molecular Weight

Approximately 37-48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

2810025M15Rik (BC055845) Mouse Tagged ORF Clone
MR200522 10 µg

2810025M15Rik (BC055845) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Alpha 2C Adrenergic Receptor (ADRA2C) Antibody (PE)
abx444408 100 µg

Alpha 2C Adrenergic Receptor (ADRA2C) Antibody (PE)

Sign In for Pricing
View Details
Rabbit anti-Oryza sativa subsp. japonica (Rice) SWEET4 Polyclonal Antibody
MBS7198883 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) SWEET4 Polyclonal Antibody

Sign In for Pricing
View Details
TSPAN4 Rabbit Polyclonal Antibody
TA382904 100 µL

TSPAN4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse IgG1, kappa Isotype Control Antibody (MOPC-21), PE
FMJ92822 100 Tests

Mouse IgG1, kappa Isotype Control Antibody (MOPC-21), PE

Sign In for Pricing
View Details
FGF21 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9E5]
TA502788BM 100 µL

FGF21 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9E5]

Sign In for Pricing
View Details