Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP, Human (HEK293, hFc)

The GIP protein is a member of the glucagon superfamily, an important incretin hormone that stimulates pancreatic beta cells to secrete insulin in response to food intake. Through its G protein-coupled receptor, it activates adenylyl cyclase and other signal transduction pathways. GIP Protein, Human (HEK293, hFc) is the recombinant human-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

GIP Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gip-protein-human-hek293-fc-solution.html

Purity

98.0

Smiles

EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Molecular Formula

2695 (Gene_ID) NP_004114.1 (E22-Q93) (Accession)

Molecular Weight

Approximately 37-48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cenpo sgRNA CRISPR Lentivector (Mouse) (Target 1)
K5007602 1.0 µg DNA

Cenpo sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
ZFN2A rabbit pAb
UB-GEN-12060 100 µL

ZFN2A rabbit pAb

Sign In for Pricing
View Details
Seh1l-set siRNA/shRNA/RNAi Lentivector (Mouse)
43324094 4x 500 ng

Seh1l-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Mouse Cell cycle checkpoint protein RAD17 (RAD17) ELISA Kit
abx541270 96 Tests

Mouse Cell cycle checkpoint protein RAD17 (RAD17) ELISA Kit

Sign In for Pricing
View Details
EKV3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0672605 3x 1.0 µg

EKV3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
OSBPL9 (NM_148909) Human Recombinant Protein
TP311520L 1 mg

OSBPL9 (NM_148909) Human Recombinant Protein

Sign In for Pricing
View Details