Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP, Human (HEK293, hFc)

The GIP protein is a member of the glucagon superfamily, an important incretin hormone that stimulates pancreatic beta cells to secrete insulin in response to food intake. Through its G protein-coupled receptor, it activates adenylyl cyclase and other signal transduction pathways. GIP Protein, Human (HEK293, hFc) is the recombinant human-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

GIP Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gip-protein-human-hek293-fc-solution.html

Purity

98.0

Smiles

EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Molecular Formula

2695 (Gene_ID) NP_004114.1 (E22-Q93) (Accession)

Molecular Weight

Approximately 37-48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Laptm4b (NM_001013174) Rat Tagged Lenti ORF Clone
RR204081L4 10 µg

Laptm4b (NM_001013174) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MAPK6 (ERK3, PRKM6) discontinued
511345 100 µg

MAPK6 (ERK3, PRKM6) discontinued

Sign In for Pricing
View Details
1,6-Bis(2,3-epoxypropoxy)hexane
TRC-E585923-10G 10 g

1,6-Bis(2,3-epoxypropoxy)hexane

Sign In for Pricing
View Details
UQCRQ Protein Lysate (Rat) with C-HA Tag
49244036 100 µg

UQCRQ Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans ubc-7 Polyclonal Antibody
MBS7158229 Inquire

Rabbit anti-Caenorhabditis elegans ubc-7 Polyclonal Antibody

Sign In for Pricing
View Details
1-Deoxy-1-iodo-2,3:4,5-di-O-isopropylidene-β-D-fructopyranose
GC9238-500mg 500 mg

1-Deoxy-1-iodo-2,3:4,5-di-O-isopropylidene-β-D-fructopyranose

Sign In for Pricing
View Details