Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP, Human (HEK293, hFc)

The GIP protein is a member of the glucagon superfamily, an important incretin hormone that stimulates pancreatic beta cells to secrete insulin in response to food intake. Through its G protein-coupled receptor, it activates adenylyl cyclase and other signal transduction pathways. GIP Protein, Human (HEK293, hFc) is the recombinant human-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

GIP Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gip-protein-human-hek293-fc-solution.html

Purity

98.0

Smiles

EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Molecular Formula

2695 (Gene_ID) NP_004114.1 (E22-Q93) (Accession)

Molecular Weight

Approximately 37-48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

XRCC6BP1 (ATP23) Mouse Monoclonal Antibody [Clone ID: OTI3C5]
TA808435S 30 µL

XRCC6BP1 (ATP23) Mouse Monoclonal Antibody [Clone ID: OTI3C5]

Sign In for Pricing
View Details
Recombinant Mycobacterium Ulcerans trpD Protein (aa 1-367)
VAng-Yyj3861-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Ulcerans trpD Protein (aa 1-367)

Sign In for Pricing
View Details
Mouse Monoclonal Lipocalin-2/NGAL Antibody (28) [Alexa Fluor 750]
NBP1-30006AF750 0.1 mL

Mouse Monoclonal Lipocalin-2/NGAL Antibody (28) [Alexa Fluor 750]

Sign In for Pricing
View Details
Sterilization basket
1213929 1 PC

Sterilization basket

Sign In for Pricing
View Details
Vnn3-set siRNA/shRNA/RNAi Lentivector (Rat)
49983096 4x 500 ng

Vnn3-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
DMAPT
abx282803-01 5 mg

DMAPT

Sign In for Pricing
View Details