Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP, Human (HEK293, hFc)

The GIP protein is a member of the glucagon superfamily, an important incretin hormone that stimulates pancreatic beta cells to secrete insulin in response to food intake. Through its G protein-coupled receptor, it activates adenylyl cyclase and other signal transduction pathways. GIP Protein, Human (HEK293, hFc) is the recombinant human-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

GIP Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gip-protein-human-hek293-fc-solution.html

Purity

98.0

Smiles

EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Molecular Formula

2695 (Gene_ID) NP_004114.1 (E22-Q93) (Accession)

Molecular Weight

Approximately 37-48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ZWILCH shRNA (UAS) - Lentiviral human ZWILCH shRNA (UAS) (25)
GTR15335636 1 Vial

Lentiviral human ZWILCH shRNA (UAS) - Lentiviral human ZWILCH shRNA (UAS) (25)

Sign In for Pricing
View Details
Ebastine-d5
011028 1 mg

Ebastine-d5

Sign In for Pricing
View Details
DiagNano™ Green Fluorescent Silica Nanoparticles, 30 nm
DNG-L008 10 mL

DiagNano™ Green Fluorescent Silica Nanoparticles, 30 nm

Sign In for Pricing
View Details
Cytokeratin 19 (CK19) DIY ELISA Kit
MBS2163103-01 5x 96 Tests

Cytokeratin 19 (CK19) DIY ELISA Kit

Sign In for Pricing
View Details
Cytokeratin 19 (CK19) DIY ELISA Kit
MBS2163103-02 5x 96 Tests + MBS2089471 (Support Pack 1,5x 96 Tests)

Cytokeratin 19 (CK19) DIY ELISA Kit

Sign In for Pricing
View Details
Cytokeratin 19 (CK19) DIY ELISA Kit
MBS2163103-03 10x 96 Tests

Cytokeratin 19 (CK19) DIY ELISA Kit

Sign In for Pricing
View Details