Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP, Human (HEK293, hFc)

The GIP protein is a member of the glucagon superfamily, an important incretin hormone that stimulates pancreatic beta cells to secrete insulin in response to food intake. Through its G protein-coupled receptor, it activates adenylyl cyclase and other signal transduction pathways. GIP Protein, Human (HEK293, hFc) is the recombinant human-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

GIP Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gip-protein-human-hek293-fc-solution.html

Purity

98.0

Smiles

EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Molecular Formula

2695 (Gene_ID) NP_004114.1 (E22-Q93) (Accession)

Molecular Weight

Approximately 37-48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Matrix Metalloproteinase 2 (MMP-2, Collagenase IV, Gelatinase A) (BSA & Azide Free) (PE) discontinued
M2420-76X-PE 100 µL

Matrix Metalloproteinase 2 (MMP-2, Collagenase IV, Gelatinase A) (BSA & Azide Free) (PE) discontinued

Sign In for Pricing
View Details
Recombinant Mouse anti-SARS-CoV-02/COVID-019 S Monoclonal Antibody
MAV118 1 mg

Recombinant Mouse anti-SARS-CoV-02/COVID-019 S Monoclonal Antibody

Sign In for Pricing
View Details
CLD23 rabbit pAb
ES9550-01 50 µL

CLD23 rabbit pAb

Sign In for Pricing
View Details
CLD23 rabbit pAb
ES9550-02 100 µL

CLD23 rabbit pAb

Sign In for Pricing
View Details
TCERG1 Polyclonal Antibody, RBITC Conjugated
bs-6801R-RBITC 100 µL

TCERG1 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Anti-Notch Homolog 2 (NOTCH2)
FY-AB46253-01 1 mL

Anti-Notch Homolog 2 (NOTCH2)

Sign In for Pricing
View Details