Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP, Human (HEK293, hFc)

The GIP protein is a member of the glucagon superfamily, an important incretin hormone that stimulates pancreatic beta cells to secrete insulin in response to food intake. Through its G protein-coupled receptor, it activates adenylyl cyclase and other signal transduction pathways. GIP Protein, Human (HEK293, hFc) is the recombinant human-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

GIP Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gip-protein-human-hek293-fc-solution.html

Purity

98.0

Smiles

EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Molecular Formula

2695 (Gene_ID) NP_004114.1 (E22-Q93) (Accession)

Molecular Weight

Approximately 37-48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3E Mouse Monoclonal Antibody [Clone ID: UCHT1]
AMM17662VCF 100 µg

CD3E Mouse Monoclonal Antibody [Clone ID: UCHT1]

Sign In for Pricing
View Details
Human GALM AssayLite™ Antibody (RPE Conjugate)
32979-05151 5x 30 µg

Human GALM AssayLite™ Antibody (RPE Conjugate)

Sign In for Pricing
View Details
TrkB (NTRK2) Rabbit Polyclonal Antibody
TA325756 100 µL

TrkB (NTRK2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Slc25a24 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
44006114 3x 1.0 µg

Slc25a24 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Recombinant Baumannia cicadellinicola subsp. Homalodisca coagulata Adenylate kinase (adk)
MBS1411284-01 0.02 mg (E-Coli)

Recombinant Baumannia cicadellinicola subsp. Homalodisca coagulata Adenylate kinase (adk)

Sign In for Pricing
View Details
Recombinant Baumannia cicadellinicola subsp. Homalodisca coagulata Adenylate kinase (adk)
MBS1411284-02 0.1 mg (E-Coli)

Recombinant Baumannia cicadellinicola subsp. Homalodisca coagulata Adenylate kinase (adk)

Sign In for Pricing
View Details