GIP, Human (HEK293, hFc)
The GIP protein is a member of the glucagon superfamily, an important incretin hormone that stimulates pancreatic beta cells to secrete insulin in response to food intake. Through its G protein-coupled receptor, it activates adenylyl cyclase and other signal transduction pathways. GIP Protein, Human (HEK293, hFc) is the recombinant human-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag.
Product Specifications
Product Name Alternative
GIP Protein, Human (HEK293, hFc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gip-protein-human-hek293-fc-solution.html
Purity
98.0
Smiles
EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Molecular Formula
2695 (Gene_ID) NP_004114.1 (E22-Q93) (Accession)
Molecular Weight
Approximately 37-48 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
TCF 1 (Transcription Factor 1, TCF1, TCF-1, Hepatocyte Nuclear Factor 1-alpha, HNF-1-alpha, HNF1A, HNF-1A, HNF1, IDDM20, Liver-specific Transcription Factor LF-B1, LFB1, MODY3) (Biotin)
TCF 1 (Transcription Factor 1, TCF1, TCF-1, Hepatocyte Nuclear Factor 1-alpha, HNF-1-alpha, HNF1A, HNF-1A, HNF1, IDDM20, Liver-specific Transcription Factor LF-B1, LFB1, MODY3) (Biotin)
Rabbit Polyclonal PLEKHA7 Antibody [DyLight 550]
Rabbit anti-Escherichia coli (strain 55989/EAEC) yfbR Polyclonal Antibody
Bovine Myosin Heavy Chain 7, Cardiac Muscle, Beta ELISA Kit