Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP, Human (HEK293, hFc)

The GIP protein is a member of the glucagon superfamily, an important incretin hormone that stimulates pancreatic beta cells to secrete insulin in response to food intake. Through its G protein-coupled receptor, it activates adenylyl cyclase and other signal transduction pathways. GIP Protein, Human (HEK293, hFc) is the recombinant human-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

GIP Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gip-protein-human-hek293-fc-solution.html

Purity

98.0

Smiles

EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Molecular Formula

2695 (Gene_ID) NP_004114.1 (E22-Q93) (Accession)

Molecular Weight

Approximately 37-48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCNL1 Antibody
A16353-100UL 100 µL

CCNL1 Antibody

Sign In for Pricing
View Details
Efna5 Rat shRNA Lentiviral Particle (Locus ID 116683)
TL712245V 500 µL Each

Efna5 Rat shRNA Lentiviral Particle (Locus ID 116683)

Sign In for Pricing
View Details
Recombinant Human CUL5 Protein
E30P5293 20 µg

Recombinant Human CUL5 Protein

Sign In for Pricing
View Details
HIST1H2BO (H2BC17) (NM_003527) Human Tagged Lenti ORF Clone
RC219561L4 10 µg

HIST1H2BO (H2BC17) (NM_003527) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rat Fibronectin Type Iii Domain-Containing Protein 5 (Fndc5) Elisa Kit
EKC39049 96 Tests

Rat Fibronectin Type Iii Domain-Containing Protein 5 (Fndc5) Elisa Kit

Sign In for Pricing
View Details
5-Fluoroisatin
GK4345-25g 25 g

5-Fluoroisatin

Sign In for Pricing
View Details