Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP, Human (HEK293, hFc)

The GIP protein is a member of the glucagon superfamily, an important incretin hormone that stimulates pancreatic beta cells to secrete insulin in response to food intake. Through its G protein-coupled receptor, it activates adenylyl cyclase and other signal transduction pathways. GIP Protein, Human (HEK293, hFc) is the recombinant human-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

GIP Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gip-protein-human-hek293-fc-solution.html

Purity

98.0

Smiles

EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Molecular Formula

2695 (Gene_ID) NP_004114.1 (E22-Q93) (Accession)

Molecular Weight

Approximately 37-48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nestin (NES) Antibody (FITC)
abx315318-01 20 µg

Nestin (NES) Antibody (FITC)

Sign In for Pricing
View Details
Nestin (NES) Antibody (FITC)
abx315318-02 50 µg

Nestin (NES) Antibody (FITC)

Sign In for Pricing
View Details
Nestin (NES) Antibody (FITC)
abx315318-03 100 µg

Nestin (NES) Antibody (FITC)

Sign In for Pricing
View Details
Nestin (NES) Antibody (FITC)
abx315318-04 200 µg

Nestin (NES) Antibody (FITC)

Sign In for Pricing
View Details
Nestin (NES) Antibody (FITC)
abx315318-05 1 mg

Nestin (NES) Antibody (FITC)

Sign In for Pricing
View Details
2-Chlorophenyl Acetic Acid 99% For Synthesis
00783 00025 25 g

2-Chlorophenyl Acetic Acid 99% For Synthesis

Sign In for Pricing
View Details