Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP, Human (HEK293, hFc)

The GIP protein is a member of the glucagon superfamily, an important incretin hormone that stimulates pancreatic beta cells to secrete insulin in response to food intake. Through its G protein-coupled receptor, it activates adenylyl cyclase and other signal transduction pathways. GIP Protein, Human (HEK293, hFc) is the recombinant human-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

GIP Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gip-protein-human-hek293-fc-solution.html

Purity

98.0

Smiles

EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Molecular Formula

2695 (Gene_ID) NP_004114.1 (E22-Q93) (Accession)

Molecular Weight

Approximately 37-48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EYA1 Antibody
A66155-50UG 50 µg

EYA1 Antibody

Sign In for Pricing
View Details
LOC635310 Mouse siRNA Oligo Duplex (Locus ID 635310)
SR407257 1 Kit

LOC635310 Mouse siRNA Oligo Duplex (Locus ID 635310)

Sign In for Pricing
View Details
Lentiviral mouse Psmd1 shRNA (UAS) - Lentiviral mouse Psmd1 shRNA (UAS, GFP) (100)
GTR15292509 1 Vial

Lentiviral mouse Psmd1 shRNA (UAS) - Lentiviral mouse Psmd1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Recombinant Chlamydophila Trachomatis rplY Protein (aa 1-185) (strain D/UW-3/Cx)
VAng-Lsx7135-1mgEcoli 1 mg (E. coli)

Recombinant Chlamydophila Trachomatis rplY Protein (aa 1-185) (strain D/UW-3/Cx)

Sign In for Pricing
View Details
Human Olfactory receptor 11A1 (OR11A1) ELISA Kit
abx536434 96 Tests

Human Olfactory receptor 11A1 (OR11A1) ELISA Kit

Sign In for Pricing
View Details
DCDC2 (NM_016356) Human Over-expression Lysate
LC414031 20 µg

DCDC2 (NM_016356) Human Over-expression Lysate

Sign In for Pricing
View Details