Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP, Human (HEK293, hFc)

The GIP protein is a member of the glucagon superfamily, an important incretin hormone that stimulates pancreatic beta cells to secrete insulin in response to food intake. Through its G protein-coupled receptor, it activates adenylyl cyclase and other signal transduction pathways. GIP Protein, Human (HEK293, hFc) is the recombinant human-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

GIP Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gip-protein-human-hek293-fc-solution.html

Purity

98.0

Smiles

EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Molecular Formula

2695 (Gene_ID) NP_004114.1 (E22-Q93) (Accession)

Molecular Weight

Approximately 37-48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amd1 Rat shRNA Lentiviral Particle (Locus ID 81640)
TL711142V 500 µL Each

Amd1 Rat shRNA Lentiviral Particle (Locus ID 81640)

Sign In for Pricing
View Details
Recombinant Human Membrane cofactor protein (CD46), partial
CSB-EP004939HU1-01 20 µg

Recombinant Human Membrane cofactor protein (CD46), partial

Sign In for Pricing
View Details
Recombinant Human Membrane cofactor protein (CD46), partial
CSB-EP004939HU1-02 100 µg

Recombinant Human Membrane cofactor protein (CD46), partial

Sign In for Pricing
View Details
Recombinant Human Membrane cofactor protein (CD46), partial
CSB-EP004939HU1-03 1 mg

Recombinant Human Membrane cofactor protein (CD46), partial

Sign In for Pricing
View Details
Human Cyclin B ELISA Kit
MBS103343-01 48 Well

Human Cyclin B ELISA Kit

Sign In for Pricing
View Details
Human Cyclin B ELISA Kit
MBS103343-02 96 Well

Human Cyclin B ELISA Kit

Sign In for Pricing
View Details