Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP, Human (HEK293, hFc)

The GIP protein is a member of the glucagon superfamily, an important incretin hormone that stimulates pancreatic beta cells to secrete insulin in response to food intake. Through its G protein-coupled receptor, it activates adenylyl cyclase and other signal transduction pathways. GIP Protein, Human (HEK293, hFc) is the recombinant human-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

GIP Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gip-protein-human-hek293-fc-solution.html

Purity

98.0

Smiles

EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Molecular Formula

2695 (Gene_ID) NP_004114.1 (E22-Q93) (Accession)

Molecular Weight

Approximately 37-48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMARCA2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV629792 1.0 µg DNA

SMARCA2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Recombinant Human AKT-interacting protein Protein, His-SUMO, E.coli-500ug
QP8053-ec-500ug 500ug

Recombinant Human AKT-interacting protein Protein, His-SUMO, E.coli-500ug

Sign In for Pricing
View Details
REMBRANDT® CEP14/22-ISH biotin detection assay
C714K.0100.10 10 Assays

REMBRANDT® CEP14/22-ISH biotin detection assay

Sign In for Pricing
View Details
Recombinant Human M6PR Protein, His (Fc)-Avi-tagged
M6PR-1335H 50 µg

Recombinant Human M6PR Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
RASAL3 Protein Vector (Rat) (pPB-N-His)
PV298219 500 ng

RASAL3 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
TBX4 Antibody
MBS7110011-01 0.05 mg

TBX4 Antibody

Sign In for Pricing
View Details