Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP, Human (HEK293, hFc)

The GIP protein is a member of the glucagon superfamily, an important incretin hormone that stimulates pancreatic beta cells to secrete insulin in response to food intake. Through its G protein-coupled receptor, it activates adenylyl cyclase and other signal transduction pathways. GIP Protein, Human (HEK293, hFc) is the recombinant human-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

GIP Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gip-protein-human-hek293-fc-solution.html

Purity

98.0

Smiles

EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Molecular Formula

2695 (Gene_ID) NP_004114.1 (E22-Q93) (Accession)

Molecular Weight

Approximately 37-48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD24 Protein Vector (Rat) (pPM-C-His)
PV258525 500 ng

CD24 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
E-cadherin discontinued
388509 200 µL

E-cadherin discontinued

Sign In for Pricing
View Details
Anti-Human CD66a/CEACAM1 Antibody (SAA0761), PE
HB880127-01 1 Each

Anti-Human CD66a/CEACAM1 Antibody (SAA0761), PE

Sign In for Pricing
View Details
Anti-Human CD66a/CEACAM1 Antibody (SAA0761), PE
HB880127-02 100 Tests

Anti-Human CD66a/CEACAM1 Antibody (SAA0761), PE

Sign In for Pricing
View Details
FBXO42 Protein Vector (Human) (pPB-C-His)
PV015901 500 ng

FBXO42 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
AGN 194078 10mg
A20387-10 10 mg

AGN 194078 10mg

Sign In for Pricing
View Details