Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP, Human (HEK293, hFc)

The GIP protein is a member of the glucagon superfamily, an important incretin hormone that stimulates pancreatic beta cells to secrete insulin in response to food intake. Through its G protein-coupled receptor, it activates adenylyl cyclase and other signal transduction pathways. GIP Protein, Human (HEK293, hFc) is the recombinant human-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

GIP Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gip-protein-human-hek293-fc-solution.html

Purity

98.0

Smiles

EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Molecular Formula

2695 (Gene_ID) NP_004114.1 (E22-Q93) (Accession)

Molecular Weight

Approximately 37-48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pigc (NM_001012207) Rat Untagged Clone
RN206609 10 µg

Pigc (NM_001012207) Rat Untagged Clone

Sign In for Pricing
View Details
Recombinant Escherichia coli Cobalamin synthase (cobS), partial
MBS7071586 Inquire

Recombinant Escherichia coli Cobalamin synthase (cobS), partial

Sign In for Pricing
View Details
Colec12 (NM_130449) Mouse Tagged Lenti ORF Clone
MR210412L4 10 µg

Colec12 (NM_130449) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
VSNL1 Protein Vector (Human) (pPB-N-His)
PV045938 500 ng

VSNL1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
PRDM2 discontinued
393319 200 µL

PRDM2 discontinued

Sign In for Pricing
View Details
ATP11A (NM_015205) Human Untagged Clone
SC304255 10 µg

ATP11A (NM_015205) Human Untagged Clone

Sign In for Pricing
View Details