Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP, Human (HEK293, hFc)

The GIP protein is a member of the glucagon superfamily, an important incretin hormone that stimulates pancreatic beta cells to secrete insulin in response to food intake. Through its G protein-coupled receptor, it activates adenylyl cyclase and other signal transduction pathways. GIP Protein, Human (HEK293, hFc) is the recombinant human-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

GIP Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gip-protein-human-hek293-fc-solution.html

Purity

98.0

Smiles

EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Molecular Formula

2695 (Gene_ID) NP_004114.1 (E22-Q93) (Accession)

Molecular Weight

Approximately 37-48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPAPDC2 Over-expression Lysate Product
GWB-7F2D15 0.1 mg

PPAPDC2 Over-expression Lysate Product

Sign In for Pricing
View Details
(+)-Isolysergic Acid Diethylamide-d10
TRC-I821062-10MG 10 mg

(+)-Isolysergic Acid Diethylamide-d10

Sign In for Pricing
View Details
Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) RXRBA Polyclonal Antibody
MBS7199173 Inquire

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) RXRBA Polyclonal Antibody

Sign In for Pricing
View Details
QARS (QARS1) (NM_005051) Human Tagged Lenti ORF Clone
RC201784L2 10 µg

QARS (QARS1) (NM_005051) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TRPM6 (Transient Receptor Potential Cation Channel Subfamily M, Member 6)
369654 200 µL

TRPM6 (Transient Receptor Potential Cation Channel Subfamily M, Member 6)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Putative gustatory receptor 22a (Gr22a)
MBS7016300-01 0.02 mg

Recombinant Drosophila melanogaster Putative gustatory receptor 22a (Gr22a)

Sign In for Pricing
View Details