Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP, Human (HEK293, hFc)

The GIP protein is a member of the glucagon superfamily, an important incretin hormone that stimulates pancreatic beta cells to secrete insulin in response to food intake. Through its G protein-coupled receptor, it activates adenylyl cyclase and other signal transduction pathways. GIP Protein, Human (HEK293, hFc) is the recombinant human-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

GIP Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gip-protein-human-hek293-fc-solution.html

Purity

98.0

Smiles

EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Molecular Formula

2695 (Gene_ID) NP_004114.1 (E22-Q93) (Accession)

Molecular Weight

Approximately 37-48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF161 (VEZF1) (NM_007146) Human Tagged Lenti ORF Clone
RC222182L4 10 µg

ZNF161 (VEZF1) (NM_007146) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CAPS2 sgRNA CRISPR Lentivector (Human) (Target 3)
K0361904 1.0 µg DNA

CAPS2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
SCPEP1 Protein Vector (Human) (pPM-C-His)
PV037052 500 ng

SCPEP1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
ETS2, ID (ETS2, Protein C-ets-2) (MaxLight 490) discontinued
035250-ML490 100 µL

ETS2, ID (ETS2, Protein C-ets-2) (MaxLight 490) discontinued

Sign In for Pricing
View Details
APCS monoclonal antibody
MB66780-01 50 µL

APCS monoclonal antibody

Sign In for Pricing
View Details
APCS monoclonal antibody
MB66780-02 100 µL

APCS monoclonal antibody

Sign In for Pricing
View Details