Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP, Human (HEK293, hFc)

The GIP protein is a member of the glucagon superfamily, an important incretin hormone that stimulates pancreatic beta cells to secrete insulin in response to food intake. Through its G protein-coupled receptor, it activates adenylyl cyclase and other signal transduction pathways. GIP Protein, Human (HEK293, hFc) is the recombinant human-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

GIP Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gip-protein-human-hek293-fc-solution.html

Purity

98.0

Smiles

EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Molecular Formula

2695 (Gene_ID) NP_004114.1 (E22-Q93) (Accession)

Molecular Weight

Approximately 37-48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP4C Protein Vector (Rat) (pPB-C-His)
PV295802 500 ng

PPP4C Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Rat macrophage inflammatory protein 1β,MIP-1β ELISA kit
CN-01512R1 96T

Rat macrophage inflammatory protein 1β,MIP-1β ELISA kit

Sign In for Pricing
View Details
Lentiviral human PRR32 shRNA (UAS) - Lentiviral human PRR32 shRNA (UAS) (100)
GTR15151074 1 Vial

Lentiviral human PRR32 shRNA (UAS) - Lentiviral human PRR32 shRNA (UAS) (100)

Sign In for Pricing
View Details
AAGAB sgRNA CRISPR Lentivector set (Human)
K2744801 3x 1.0 µg

AAGAB sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
PDC-TREM CRISPR Activation Plasmid (m2)
sc-435917-ACT-2 20 µg

PDC-TREM CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
C11orf62 siRNA Oligos set (Human)
53572171 3x 5 nmol

C11orf62 siRNA Oligos set (Human)

Sign In for Pricing
View Details