GIP, Human (HEK293, hFc)
The GIP protein is a member of the glucagon superfamily, an important incretin hormone that stimulates pancreatic beta cells to secrete insulin in response to food intake. Through its G protein-coupled receptor, it activates adenylyl cyclase and other signal transduction pathways. GIP Protein, Human (HEK293, hFc) is the recombinant human-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag.
Product Specifications
Product Name Alternative
GIP Protein, Human (HEK293, hFc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gip-protein-human-hek293-fc-solution.html
Purity
98.0
Smiles
EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Molecular Formula
2695 (Gene_ID) NP_004114.1 (E22-Q93) (Accession)
Molecular Weight
Approximately 37-48 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Goat Integral Membrane Protein GPR155 (GPR155) ELISA Kit
Lentiviral human EPB41L2 sgRNA gene knockout kit - Lentiviral human EPB41L2 sgRNA gene knockout kit (25)
Recombinant Mouse Trifunctional enzyme subunit beta, mitochondrial (Hadhb)
Recombinant Mouse Trifunctional enzyme subunit beta, mitochondrial (Hadhb)
Recombinant Mouse Trifunctional enzyme subunit beta, mitochondrial (Hadhb)