Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP, Human (HEK293, hFc)

The GIP protein is a member of the glucagon superfamily, an important incretin hormone that stimulates pancreatic beta cells to secrete insulin in response to food intake. Through its G protein-coupled receptor, it activates adenylyl cyclase and other signal transduction pathways. GIP Protein, Human (HEK293, hFc) is the recombinant human-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

GIP Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gip-protein-human-hek293-fc-solution.html

Purity

98.0

Smiles

EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Molecular Formula

2695 (Gene_ID) NP_004114.1 (E22-Q93) (Accession)

Molecular Weight

Approximately 37-48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TM9SF3 Protein Lysate (Human) with C-Ha Tag
46807031 100 µg

TM9SF3 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Hsp40 (DNAJB1) (NM_006145) Human Over-expression Lysate
LS003337-100ug 100 µg

Hsp40 (DNAJB1) (NM_006145) Human Over-expression Lysate

Sign In for Pricing
View Details
Riociguat-d6
TRC-R520003-10MG 10 mg

Riociguat-d6

Sign In for Pricing
View Details
CDC42 (Cell Division Control Protein 42 Homolog, CDC42Hs, G25K) (MaxLight 550)
MBS6410674-01 0.1 mL

CDC42 (Cell Division Control Protein 42 Homolog, CDC42Hs, G25K) (MaxLight 550)

Sign In for Pricing
View Details
CDC42 (Cell Division Control Protein 42 Homolog, CDC42Hs, G25K) (MaxLight 550)
MBS6410674-02 5x 0.1 mL

CDC42 (Cell Division Control Protein 42 Homolog, CDC42Hs, G25K) (MaxLight 550)

Sign In for Pricing
View Details
ZBED3 Protein Vector (Human) (pPB-N-His)
PV144211 500 ng

ZBED3 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details