Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP, Human (HEK293, hFc)

The GIP protein is a member of the glucagon superfamily, an important incretin hormone that stimulates pancreatic beta cells to secrete insulin in response to food intake. Through its G protein-coupled receptor, it activates adenylyl cyclase and other signal transduction pathways. GIP Protein, Human (HEK293, hFc) is the recombinant human-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

GIP Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gip-protein-human-hek293-fc-solution.html

Purity

98.0

Smiles

EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Molecular Formula

2695 (Gene_ID) NP_004114.1 (E22-Q93) (Accession)

Molecular Weight

Approximately 37-48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Autophagy Related 4B Cysteine Peptidase (ATG4B) Antibody (ATTO 633)
abx447087 100 µg

Autophagy Related 4B Cysteine Peptidase (ATG4B) Antibody (ATTO 633)

Sign In for Pricing
View Details
USP14 AAV siRNA Pooled Vector
49283161 1.0 µg

USP14 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Matn4 3'UTR GFP Stable Cell Line
TU162945 1.0 mL

Matn4 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Lentiviral human TNFSF14 shRNA (UAS) - Lentiviral human TNFSF14 shRNA (UAS) (100)
GTR15099054 1 Vial

Lentiviral human TNFSF14 shRNA (UAS) - Lentiviral human TNFSF14 shRNA (UAS) (100)

Sign In for Pricing
View Details
IFNA4 Human Gene Knockout Kit (CRISPR)
KN423649 1 Kit

IFNA4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Lentiviral mouse Defa38 shRNA (UAS) - Lentiviral mouse Defa38 shRNA (UAS, RFP) (100)
GTR15222432 1 Vial

Lentiviral mouse Defa38 shRNA (UAS) - Lentiviral mouse Defa38 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details