Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP, Human (HEK293, hFc)

The GIP protein is a member of the glucagon superfamily, an important incretin hormone that stimulates pancreatic beta cells to secrete insulin in response to food intake. Through its G protein-coupled receptor, it activates adenylyl cyclase and other signal transduction pathways. GIP Protein, Human (HEK293, hFc) is the recombinant human-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

GIP Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gip-protein-human-hek293-fc-solution.html

Purity

98.0

Smiles

EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Molecular Formula

2695 (Gene_ID) NP_004114.1 (E22-Q93) (Accession)

Molecular Weight

Approximately 37-48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Agar, Noble
40100068-2 500 g

Agar, Noble

Sign In for Pricing
View Details
Donkey Von Willebrand Factor A Domain Containing Protein 5A (VWA5A) ELISA Kit
MBS9927862 Inquire

Donkey Von Willebrand Factor A Domain Containing Protein 5A (VWA5A) ELISA Kit

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike RBD(V503F)(His Tag)
MBS2567872-01 0.1 mg

Recombinant SARS-CoV-2 Spike RBD(V503F)(His Tag)

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike RBD(V503F)(His Tag)
MBS2567872-02 5x 0.1 mg

Recombinant SARS-CoV-2 Spike RBD(V503F)(His Tag)

Sign In for Pricing
View Details
TFAP2B (Transcription Factor AP-2-beta, AP2-beta, Activating Enhancer-binding Protein 2-beta, MGC21381) (MaxLight 405) discontinued
134351-ML405 100 µL

TFAP2B (Transcription Factor AP-2-beta, AP2-beta, Activating Enhancer-binding Protein 2-beta, MGC21381) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Pus10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
38211114 3x 1.0 µg

Pus10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details