Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP, Human (HEK293, hFc)

The GIP protein is a member of the glucagon superfamily, an important incretin hormone that stimulates pancreatic beta cells to secrete insulin in response to food intake. Through its G protein-coupled receptor, it activates adenylyl cyclase and other signal transduction pathways. GIP Protein, Human (HEK293, hFc) is the recombinant human-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

GIP Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gip-protein-human-hek293-fc-solution.html

Purity

98.0

Smiles

EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Molecular Formula

2695 (Gene_ID) NP_004114.1 (E22-Q93) (Accession)

Molecular Weight

Approximately 37-48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SKAR Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-7922R-BF750 100 µL

SKAR Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
CCYL1, NT (CCNYL1, Cyclin-Y-like protein 1) (PE)
MBS6282706-01 0.2 mL

CCYL1, NT (CCNYL1, Cyclin-Y-like protein 1) (PE)

Sign In for Pricing
View Details
CCYL1, NT (CCNYL1, Cyclin-Y-like protein 1) (PE)
MBS6282706-02 5x 0.2 mL

CCYL1, NT (CCNYL1, Cyclin-Y-like protein 1) (PE)

Sign In for Pricing
View Details
TLR7 (Toll-like Receptor 7) (MaxLight 550)
MBS6219735-01 0.1 mL

TLR7 (Toll-like Receptor 7) (MaxLight 550)

Sign In for Pricing
View Details
TLR7 (Toll-like Receptor 7) (MaxLight 550)
MBS6219735-02 5x 0.1 mL

TLR7 (Toll-like Receptor 7) (MaxLight 550)

Sign In for Pricing
View Details
Human Ferritin ELISA Kit
MBS8579466-01 96 Tests

Human Ferritin ELISA Kit

Sign In for Pricing
View Details