Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli Outer membrane protein assembly factor BamA (BamA), partial

Recombinant E. coli Outer membrane protein assembly factor BamA (BamA), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: E. coli (strain K12) . Target Name: bamA. Target Synonyms: Outer membrane protein assembly factor BamA (Omp85) . Accession Number: P0A940. Expression Region: 175~424aa. Tag Info: C-Terminal 6Xhis-Tagged. Theoretical MW: 30kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli Outer membrane protein assembly factor BamA (BamA), partial is a purified Recombinant Protein.

Accession Number

P0A940

Expression Region

175~424aa

Host

Yeast

Target

BamA

Conjugation

Unconjugated

Tag

C-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

30kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Outer membrane protein assembly factor BamA (Omp85)

Species

E. coli (strain K12)

Protein Name

Recombinant Protein

AA Sequence

AEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERNTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF14 Rabbit Polyclonal Antibody (BF350)
orb2378185 100 µL

RNF14 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
DAP-3 (F-12) Alexa Fluor® 546
sc-373911 AF546 200 µg/mL

DAP-3 (F-12) Alexa Fluor® 546

Sign In for Pricing
View Details
Mouse Hoxa1 Pre-designed siRNA Set A
SI106291A 1 Each

Mouse Hoxa1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
MAP2K3 Blocking Peptide
33R-8564 100 ug

MAP2K3 Blocking Peptide

Sign In for Pricing
View Details
ESR1/ER, ID (ESR1, ESR, NR3A1, Estrogen receptor, ER-alpha, Estradiol receptor, Nuclear receptor subfamily 3 group A member 1) (MaxLight 490) discontinued
035237-ML490 100 µL

ESR1/ER, ID (ESR1, ESR, NR3A1, Estrogen receptor, ER-alpha, Estradiol receptor, Nuclear receptor subfamily 3 group A member 1) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Qrfp siRNA Oligos set (Mouse)
38269174 3x 5 nmol

Qrfp siRNA Oligos set (Mouse)

Sign In for Pricing
View Details