Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli Outer membrane protein assembly factor BamA (BamA), partial

Recombinant E. coli Outer membrane protein assembly factor BamA (BamA), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: E. coli (strain K12) . Target Name: bamA. Target Synonyms: Outer membrane protein assembly factor BamA (Omp85) . Accession Number: P0A940. Expression Region: 175~424aa. Tag Info: C-Terminal 6Xhis-Tagged. Theoretical MW: 30kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli Outer membrane protein assembly factor BamA (BamA), partial is a purified Recombinant Protein.

Accession Number

P0A940

Expression Region

175~424aa

Host

Yeast

Target

BamA

Conjugation

Unconjugated

Tag

C-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

30kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Outer membrane protein assembly factor BamA (Omp85)

Species

E. coli (strain K12)

Protein Name

Recombinant Protein

AA Sequence

AEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERNTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sinomenine hydrochloride 10mM * 1mL in DMSO
A12221-10mM-D 10 mM x 1mL in DMSO

Sinomenine hydrochloride 10mM * 1mL in DMSO

Sign In for Pricing
View Details
PKM Rabbit Polyclonal Antibody
AF7764 50 µL

PKM Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UBC6e (UBE2J1) (NM_016021) Human Over-expression Lysate
LS051465-20ug 20 µg

UBC6e (UBE2J1) (NM_016021) Human Over-expression Lysate

Sign In for Pricing
View Details
ITGAE (Integrin alpha-E, HML-1 Antigen, Integrin alpha-IEL, Mucosal Lymphocyte 1 Antigen, CD103, Integrin alpha-E Light Chain, Integrin alpha-E Heavy Chain, MGC141996) (MaxLight 490)
128631-ML490 100 µL

ITGAE (Integrin alpha-E, HML-1 Antigen, Integrin alpha-IEL, Mucosal Lymphocyte 1 Antigen, CD103, Integrin alpha-E Light Chain, Integrin alpha-E Heavy Chain, MGC141996) (MaxLight 490)

Sign In for Pricing
View Details
Vmn1r233 (NM_134202) Mouse Untagged Clone
MC212385 10 µg

Vmn1r233 (NM_134202) Mouse Untagged Clone

Sign In for Pricing
View Details
Human SLC45A1 activation kit by CRISPRa
GA109442 1 Kit

Human SLC45A1 activation kit by CRISPRa

Sign In for Pricing
View Details