Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Triggering receptor expressed on myeloid cells 2 (TREM2), partial

Recombinant Human Triggering receptor expressed on myeloid cells 2 (TREM2), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: TREM2. Target Synonyms: Triggering receptor expressed on myeloid cells 2 (TREM-2; Triggering receptor expressed on monocytes 2) . Accession Number: Q9NZC2. Expression Region: 19~174aa. Tag Info: N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 52.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Triggering receptor expressed on myeloid cells 2 (TREM2), partial is a purified Recombinant Protein.

Accession Number

Q9NZC2

Expression Region

19~174aa

Host

E. coli

Target

TREM2

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

52.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Triggering receptor expressed on myeloid cells 2 (TREM-2; Triggering receptor expressed on monocytes 2)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cspg4 ORF Vector (Rat) (pORF)
ORF065515 1.0 µg DNA

Cspg4 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Human anti-human NT-proBNP mAb (C3)
E4A09G05-C3-100 100 µg

Human anti-human NT-proBNP mAb (C3)

Sign In for Pricing
View Details
OlFactory Receptor 10G2 (OR10G2) Human ELISA Kit
F5359 96 Tests

OlFactory Receptor 10G2 (OR10G2) Human ELISA Kit

Sign In for Pricing
View Details
BAP1 Antibody - C-terminal region : HRP (ARP63861_P050-HRP)
ARP63861_P050-HRP 100 µL

BAP1 Antibody - C-terminal region : HRP (ARP63861_P050-HRP)

Sign In for Pricing
View Details
VLDL Receptor Polyclonal Antibody, FITC Conjugated
bs-21401R-FITC 100 µL

VLDL Receptor Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
TCEAL1 (NM_001006639) Human Tagged ORF Clone
RC201528 10 µg

TCEAL1 (NM_001006639) Human Tagged ORF Clone

Sign In for Pricing
View Details