Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Triggering receptor expressed on myeloid cells 2 (TREM2), partial

Recombinant Human Triggering receptor expressed on myeloid cells 2 (TREM2), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: TREM2. Target Synonyms: Triggering receptor expressed on myeloid cells 2 (TREM-2; Triggering receptor expressed on monocytes 2) . Accession Number: Q9NZC2. Expression Region: 19~174aa. Tag Info: N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 52.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Triggering receptor expressed on myeloid cells 2 (TREM2), partial is a purified Recombinant Protein.

Accession Number

Q9NZC2

Expression Region

19~174aa

Host

E. coli

Target

TREM2

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

52.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Triggering receptor expressed on myeloid cells 2 (TREM-2; Triggering receptor expressed on monocytes 2)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COX6B1P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV759222 1.0 µg DNA

COX6B1P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
ADARB1 Protein Vector (Rat) (pPM-C-His)
PV252325 500 ng

ADARB1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Collagen 19 alpha 1 Rabbit Polyclonal Antibody
orb318790-01 30 µL

Collagen 19 alpha 1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Collagen 19 alpha 1 Rabbit Polyclonal Antibody
orb318790-02 50 μL

Collagen 19 alpha 1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Collagen 19 alpha 1 Rabbit Polyclonal Antibody
orb318790-03 100 µL

Collagen 19 alpha 1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Collagen 19 alpha 1 Rabbit Polyclonal Antibody
orb318790-04 200 µL

Collagen 19 alpha 1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details