Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H3 (ITIH3), partial

Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H3 (ITIH3), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: ITIH3. Target Synonyms: Inter-alpha-trypsin inhibitor heavy chain H3 (ITI heavy chain H3; ITI-HC3; Inter-alpha-inhibitor heavy chain 3; Serum-derived hyaluronan-associated protein; SHAP) . Accession Number: Q06033. Expression Region: 512~651aa. Tag Info: N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 51.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H3 (ITIH3), partial is a purified Recombinant Protein.

Accession Number

Q06033

Expression Region

512~651aa

Host

E. coli

Target

ITIH3

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

51.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Inter-alpha-trypsin inhibitor heavy chain H3 (ITI heavy chain H3; ITI-HC3; Inter-alpha-inhibitor heavy chain 3; Serum-derived hyaluronan-associated protein; SHAP)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MNSFKADVKGHGATNDLTFTEEVDMKEMEKALQERDYIFGNYIERLWAYLTIEQLLEKRKNAHGEEKENLTARALDLSLKYHFVTPLTSMVVTKPEDNEDERAIADKPGEDAEATPVSPAMSYLTSYQPPQNPYYYVDGD

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-Hypoxia inducible factor 1 subunit alpha Rabbit Monoclonal Antibody
9321-01 20 μL

Anti-Hypoxia inducible factor 1 subunit alpha Rabbit Monoclonal Antibody

Ask
View Details
Anti-Hypoxia inducible factor 1 subunit alpha Rabbit Monoclonal Antibody
9321-02 100 μL

Anti-Hypoxia inducible factor 1 subunit alpha Rabbit Monoclonal Antibody

Ask
View Details
CCL18 (Alternative Macrophage Activation Associated CC Chemokine 1, Alternative Macrophage Activation-associated CC Chemokine 1, AMAC-1, AMAC1, CC Chemokine PARC, CCL18 (4-69), CCL18_HUMAN, CKb7, DC-CK1, DCCK1, Dendritic Cell Chemokine 1, Macrophage Inflammatory Protein 4, MIP-4, MIP4, PARC, Pulmonary and Activation Regulated Chemokine, Pulmonary and Activation-regulated Chemokine, SCYA18, Small Inducible Cytokine A18, Small-inducible Cytokine A18)
303193 100 µg

CCL18 (Alternative Macrophage Activation Associated CC Chemokine 1, Alternative Macrophage Activation-associated CC Chemokine 1, AMAC-1, AMAC1, CC Chemokine PARC, CCL18 (4-69), CCL18_HUMAN, CKb7, DC-CK1, DCCK1, Dendritic Cell Chemokine 1, Macrophage Inflammatory Protein 4, MIP-4, MIP4, PARC, Pulmonary and Activation Regulated Chemokine, Pulmonary and Activation-regulated Chemokine, SCYA18, Small Inducible Cytokine A18, Small-inducible Cytokine A18)

Ask
View Details
Stc2 AAV siRNA Pooled Vector
45707164 1.0 µg

Stc2 AAV siRNA Pooled Vector

Ask
View Details
HDAC7 Antibody, Biotin conjugated
A46887-50UG 50 µg

HDAC7 Antibody, Biotin conjugated

Ask
View Details
Mbp (NM_001025256) Mouse Tagged ORF Clone Lentiviral Particle
MR227431L3V 200 µL

Mbp (NM_001025256) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details