Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lipopolysaccharide-binding protein (LBP), partial

Recombinant Human Lipopolysaccharide-binding protein (LBP), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: LBP. Target Synonyms: Lipopolysaccharide-binding protein (LBP) . Accession Number: P18428. Expression Region: 304~414aa. Tag Info: N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 47.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Lipopolysaccharide-binding protein (LBP), partial is a purified Recombinant Protein.

Accession Number

P18428

Expression Region

304~414aa

Host

E. coli

Target

LBP

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

47.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Lipopolysaccharide-binding protein (LBP)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

TDDMIPPDSNIRLTTKSFRPFVPRLARLYPNMNLELQGSVPSAPLLNFSPGNLSVDPYMEIDAFVLLPSSSKEPVFRLSVATNVSATLTFNTSKITGFLKPGKVKVELKES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEIL1, ID (NEIL1, Endonuclease 8-like 1, DNA glycosylase/AP lyase Neil1, DNA- (apurinic or apyrimidinic site) lyase Neil1, Endonuclease VIII-like 1, FPG1, Nei homolog 1, Nei-like protein 1) (MaxLight 490) discontinued
038880-ML490 100 µL

NEIL1, ID (NEIL1, Endonuclease 8-like 1, DNA glycosylase/AP lyase Neil1, DNA- (apurinic or apyrimidinic site) lyase Neil1, Endonuclease VIII-like 1, FPG1, Nei homolog 1, Nei-like protein 1) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal CXCR3 Antibody (49801) [DyLight 650]
FAB160W 0.1 mL

Mouse Monoclonal CXCR3 Antibody (49801) [DyLight 650]

Sign In for Pricing
View Details
SAP102 (DLG3) Rabbit Polyclonal Antibody
TA375491 100 µL

SAP102 (DLG3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Menotropin (HMG) ELISA Kit
YP-W10853-01 48 Tests

Human Menotropin (HMG) ELISA Kit

Sign In for Pricing
View Details
Human Menotropin (HMG) ELISA Kit
YP-W10853-02 96 Tests

Human Menotropin (HMG) ELISA Kit

Sign In for Pricing
View Details
Mouse Prodh activation kit by CRISPRa
GA203401 1 Kit

Mouse Prodh activation kit by CRISPRa

Sign In for Pricing
View Details