Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Appetite-regulating hormone (Ghrl)

Recombinant Mouse Appetite-regulating hormone (Ghrl) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Ghrl. Target Synonyms: Appetite-regulating hormone (Growth hormone secretagogue; Growth hormone-releasing peptide; Motilin-related peptide; Protein M46) [Cleaved into: Ghrelin; Obestatin]. Accession Number: Q9EQX0. Expression Region: 24~117aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 14.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Appetite-regulating hormone (Ghrl) is a purified Recombinant Protein.

Accession Number

Q9EQX0

Expression Region

24~117aa

Host

E. coli

Target

Ghrl

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

14.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Appetite-regulating hormone (Growth hormone secretagogue; Growth hormone-releasing peptide; Motilin-related peptide; Protein M46) [Cleaved into: Ghrelin; Obestatin]

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

GSSFLSPEHQKAQQRKESKKPPAKLQPRALEGWLHPEDRGQAEETEEELEIRFNAPFDVGIKLSGAQYQQHGRALGKFLQDILWEEVKEAPADK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM177B Antibody
MBS9430523-01 0.1 mL

FAM177B Antibody

Sign In for Pricing
View Details
FAM177B Antibody
MBS9430523-02 5x 0.1 mL

FAM177B Antibody

Sign In for Pricing
View Details
anti-cdc25C (Phospho-Ser216)
LF-PA20077 100 ul

anti-cdc25C (Phospho-Ser216)

Sign In for Pricing
View Details
MAPT, Phosphorylated (T181) (Tau Protein, Microtubule-associated Protein Tau, DDPAC, FLJ31424, FTDP-17, MAPTL, MGC138549, MSTD, MTBT1, MTBT2, PPND) (FITC)
MBS6426004-01 0.1 mL

MAPT, Phosphorylated (T181) (Tau Protein, Microtubule-associated Protein Tau, DDPAC, FLJ31424, FTDP-17, MAPTL, MGC138549, MSTD, MTBT1, MTBT2, PPND) (FITC)

Sign In for Pricing
View Details
MAPT, Phosphorylated (T181) (Tau Protein, Microtubule-associated Protein Tau, DDPAC, FLJ31424, FTDP-17, MAPTL, MGC138549, MSTD, MTBT1, MTBT2, PPND) (FITC)
MBS6426004-02 5x 0.1 mL

MAPT, Phosphorylated (T181) (Tau Protein, Microtubule-associated Protein Tau, DDPAC, FLJ31424, FTDP-17, MAPTL, MGC138549, MSTD, MTBT1, MTBT2, PPND) (FITC)

Sign In for Pricing
View Details
Bis (trimethylsilyl) acetylene
TYD-00722-01 10 g

Bis (trimethylsilyl) acetylene

Sign In for Pricing
View Details