Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Appetite-regulating hormone (Ghrl)

Recombinant Mouse Appetite-regulating hormone (Ghrl) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Ghrl. Target Synonyms: Appetite-regulating hormone (Growth hormone secretagogue; Growth hormone-releasing peptide; Motilin-related peptide; Protein M46) [Cleaved into: Ghrelin; Obestatin]. Accession Number: Q9EQX0. Expression Region: 24~117aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 14.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Appetite-regulating hormone (Ghrl) is a purified Recombinant Protein.

Accession Number

Q9EQX0

Expression Region

24~117aa

Host

E. coli

Target

Ghrl

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

14.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Appetite-regulating hormone (Growth hormone secretagogue; Growth hormone-releasing peptide; Motilin-related peptide; Protein M46) [Cleaved into: Ghrelin; Obestatin]

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

GSSFLSPEHQKAQQRKESKKPPAKLQPRALEGWLHPEDRGQAEETEEELEIRFNAPFDVGIKLSGAQYQQHGRALGKFLQDILWEEVKEAPADK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UXT (NM_153477) Human Tagged ORF Clone Lentiviral Particle
RC215815L4V 200 µL

UXT (NM_153477) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Pvu II Source : Proteus vulgaris
MBRE022-500U 1 unit

Pvu II Source : Proteus vulgaris

Sign In for Pricing
View Details
KCNK16 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1123207 1.0 µg DNA

KCNK16 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
TRPV1 (VR1, Transient Receptor Potential Cation Channel, Subfamily V, Member 1, Capsaicin Receptor, Vanilloid Receptor Type 1) discontinued
303686 100 µg

TRPV1 (VR1, Transient Receptor Potential Cation Channel, Subfamily V, Member 1, Capsaicin Receptor, Vanilloid Receptor Type 1) discontinued

Sign In for Pricing
View Details
2-Hydrazino-α- (4-hydroxy-3-methoxybenzyl) propionitrile
013276 10 mg

2-Hydrazino-α- (4-hydroxy-3-methoxybenzyl) propionitrile

Sign In for Pricing
View Details
Tsga10 sgRNA CRISPR Lentivector set (Rat)
K7468001 3x 1.0 µg

Tsga10 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details